Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2G428

Protein Details
Accession I2G428    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MADHKDKSQKGKKTRSALNDHydrophilic
79-98KNFPRRLRVRLERKRNDDEGBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MADHKDKSQKGKKTRSALNDVVTREYTVNLHKRVHDVAFKKRAPRAIKEVVSFAQKAMGTQDVRLDPKLNQEVWKYGVKNFPRRLRVRLERKRNDDEGAKEKLYTYAMPVLGLGTAKGLQTTVIDQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.79
4 0.74
5 0.7
6 0.64
7 0.57
8 0.52
9 0.44
10 0.37
11 0.29
12 0.25
13 0.21
14 0.23
15 0.28
16 0.29
17 0.31
18 0.31
19 0.34
20 0.36
21 0.37
22 0.37
23 0.35
24 0.4
25 0.47
26 0.48
27 0.5
28 0.5
29 0.54
30 0.51
31 0.52
32 0.5
33 0.49
34 0.49
35 0.45
36 0.45
37 0.39
38 0.37
39 0.32
40 0.23
41 0.19
42 0.15
43 0.14
44 0.13
45 0.15
46 0.13
47 0.13
48 0.16
49 0.14
50 0.15
51 0.16
52 0.16
53 0.13
54 0.18
55 0.21
56 0.19
57 0.2
58 0.2
59 0.22
60 0.23
61 0.27
62 0.23
63 0.23
64 0.29
65 0.32
66 0.4
67 0.46
68 0.51
69 0.56
70 0.58
71 0.6
72 0.62
73 0.67
74 0.69
75 0.72
76 0.75
77 0.75
78 0.79
79 0.82
80 0.75
81 0.69
82 0.64
83 0.6
84 0.55
85 0.51
86 0.43
87 0.37
88 0.34
89 0.31
90 0.27
91 0.21
92 0.18
93 0.18
94 0.17
95 0.17
96 0.17
97 0.15
98 0.14
99 0.14
100 0.1
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.09