Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RZ35

Protein Details
Accession A0A2J6RZ35    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-54LTKAKTKTTNSQPKLKPQPAKTNPINHydrophilic
57-78NEPSKSQSSKSQPPKSQPKFPPHydrophilic
112-135AVPASSKKIKRSPRNYIKRSNSAAHydrophilic
NLS Segment(s)
PositionSequence
121-121K
Subcellular Location(s) mito 15.5, mito_nucl 11.5, nucl 6.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MASSADIVASMRSLDLSPSPNPSKPKTELTKAKTKTTNSQPKLKPQPAKTNPINVPNEPSKSQSSKSQPPKSQPKFPPVYPVYTPLRPLPKIDGKANGGKTYQFQARAEPGAVPASSKKIKRSPRNYIKRSNSAASATQAGVSTAPMSSQPLSSPVQPKPQATSPLQQLTEEFPQQTFRYVVQVSGDSETVIGVHSELERANECAKGYVGRWGVGKSEIVDIQSSFGYRSRVVRRSWKYGISDIRVGGAWVRVLPKEFIASEEGDNKMYLAVDRSGGGLFVIGIFAQKEPAWEACKKYRDQLAYCFELEEKEQWFDGEGMFHSKGRIGDQGHHWFVVEYPLDGMVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.16
4 0.18
5 0.26
6 0.31
7 0.35
8 0.41
9 0.44
10 0.49
11 0.5
12 0.57
13 0.57
14 0.62
15 0.67
16 0.68
17 0.74
18 0.7
19 0.74
20 0.71
21 0.68
22 0.68
23 0.69
24 0.73
25 0.68
26 0.75
27 0.71
28 0.75
29 0.81
30 0.8
31 0.78
32 0.75
33 0.81
34 0.78
35 0.82
36 0.76
37 0.75
38 0.71
39 0.72
40 0.68
41 0.58
42 0.58
43 0.54
44 0.54
45 0.45
46 0.44
47 0.41
48 0.4
49 0.41
50 0.43
51 0.46
52 0.51
53 0.6
54 0.66
55 0.66
56 0.72
57 0.81
58 0.79
59 0.81
60 0.78
61 0.77
62 0.73
63 0.67
64 0.67
65 0.59
66 0.57
67 0.48
68 0.48
69 0.44
70 0.4
71 0.41
72 0.36
73 0.41
74 0.36
75 0.36
76 0.38
77 0.41
78 0.44
79 0.44
80 0.45
81 0.41
82 0.48
83 0.48
84 0.42
85 0.35
86 0.31
87 0.3
88 0.29
89 0.29
90 0.25
91 0.23
92 0.24
93 0.26
94 0.27
95 0.26
96 0.21
97 0.18
98 0.17
99 0.16
100 0.14
101 0.12
102 0.16
103 0.21
104 0.22
105 0.27
106 0.34
107 0.44
108 0.53
109 0.62
110 0.67
111 0.73
112 0.82
113 0.83
114 0.85
115 0.83
116 0.8
117 0.75
118 0.66
119 0.57
120 0.48
121 0.43
122 0.34
123 0.28
124 0.2
125 0.16
126 0.14
127 0.12
128 0.09
129 0.08
130 0.07
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.07
138 0.1
139 0.11
140 0.15
141 0.2
142 0.2
143 0.28
144 0.3
145 0.31
146 0.31
147 0.34
148 0.35
149 0.33
150 0.35
151 0.31
152 0.33
153 0.32
154 0.29
155 0.26
156 0.24
157 0.24
158 0.2
159 0.16
160 0.12
161 0.14
162 0.15
163 0.15
164 0.13
165 0.11
166 0.14
167 0.13
168 0.14
169 0.12
170 0.13
171 0.12
172 0.12
173 0.12
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.04
180 0.03
181 0.04
182 0.04
183 0.05
184 0.05
185 0.06
186 0.07
187 0.08
188 0.09
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.15
196 0.15
197 0.15
198 0.16
199 0.16
200 0.17
201 0.16
202 0.16
203 0.11
204 0.12
205 0.11
206 0.11
207 0.11
208 0.1
209 0.1
210 0.1
211 0.09
212 0.08
213 0.1
214 0.11
215 0.12
216 0.19
217 0.25
218 0.3
219 0.34
220 0.44
221 0.48
222 0.54
223 0.57
224 0.55
225 0.5
226 0.52
227 0.54
228 0.48
229 0.45
230 0.37
231 0.34
232 0.28
233 0.25
234 0.19
235 0.14
236 0.1
237 0.09
238 0.1
239 0.1
240 0.12
241 0.13
242 0.13
243 0.14
244 0.14
245 0.14
246 0.15
247 0.16
248 0.16
249 0.18
250 0.19
251 0.17
252 0.17
253 0.15
254 0.13
255 0.12
256 0.11
257 0.1
258 0.1
259 0.09
260 0.1
261 0.11
262 0.1
263 0.1
264 0.09
265 0.06
266 0.05
267 0.05
268 0.05
269 0.04
270 0.04
271 0.05
272 0.05
273 0.07
274 0.07
275 0.08
276 0.11
277 0.15
278 0.19
279 0.22
280 0.28
281 0.35
282 0.41
283 0.42
284 0.46
285 0.51
286 0.53
287 0.54
288 0.56
289 0.54
290 0.52
291 0.51
292 0.45
293 0.38
294 0.32
295 0.3
296 0.25
297 0.21
298 0.19
299 0.19
300 0.18
301 0.19
302 0.18
303 0.16
304 0.14
305 0.13
306 0.17
307 0.18
308 0.18
309 0.17
310 0.2
311 0.21
312 0.21
313 0.26
314 0.24
315 0.29
316 0.37
317 0.45
318 0.45
319 0.44
320 0.41
321 0.35
322 0.33
323 0.33
324 0.25
325 0.17
326 0.15