Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RV61

Protein Details
Accession A0A2J6RV61    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MESKPTTKAKRHKKRKSRTQVSSDSDSEHydrophilic
NLS Segment(s)
PositionSequence
7-18TKAKRHKKRKSR
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MESKPTTKAKRHKKRKSRTQVSSDSDSEPERKEVKAQKEDEKPEVPASSKDMSDAEVNDAFTKFYLQRATTEFSEDLDRLRGADDFNKDALPLLINALQQGTSLFSMEEQRRIVMAGVEKDGKKGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.96
4 0.96
5 0.94
6 0.92
7 0.9
8 0.86
9 0.81
10 0.72
11 0.62
12 0.54
13 0.46
14 0.39
15 0.32
16 0.29
17 0.25
18 0.23
19 0.28
20 0.34
21 0.41
22 0.46
23 0.49
24 0.53
25 0.59
26 0.63
27 0.6
28 0.54
29 0.47
30 0.41
31 0.38
32 0.31
33 0.24
34 0.23
35 0.2
36 0.18
37 0.17
38 0.15
39 0.15
40 0.14
41 0.14
42 0.12
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.09
49 0.1
50 0.07
51 0.09
52 0.11
53 0.11
54 0.12
55 0.15
56 0.19
57 0.17
58 0.2
59 0.18
60 0.17
61 0.18
62 0.16
63 0.15
64 0.13
65 0.12
66 0.09
67 0.1
68 0.1
69 0.09
70 0.13
71 0.15
72 0.16
73 0.17
74 0.17
75 0.16
76 0.16
77 0.15
78 0.11
79 0.08
80 0.09
81 0.1
82 0.1
83 0.11
84 0.1
85 0.1
86 0.09
87 0.09
88 0.09
89 0.07
90 0.07
91 0.07
92 0.08
93 0.16
94 0.18
95 0.22
96 0.21
97 0.21
98 0.21
99 0.22
100 0.21
101 0.18
102 0.21
103 0.19
104 0.23
105 0.28
106 0.28