Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6R2X2

Protein Details
Accession A0A2J6R2X2    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSRSPSPPRGRPRTRSPYSEAHydrophilic
203-259FDTYRPRSLSRSRSPRRHRTRSRSISSRSRSPPRRRGGRRDSPGRNGGRRRRSPSYSBasic
NLS Segment(s)
PositionSequence
11-14GRPR
31-69SPDRRRSISPRSASRSPRRNGRYRTDSRSRSPSPSRGRS
157-157K
159-255SPSPPLARRGANIDPRGPPSASFRPPPAPRRRSPPPSYGRPERNFDTYRPRSLSRSRSPRRHRTRSRSISSRSRSPPRRRGGRRDSPGRNGGRRRRS
268-281SRSRSRGRGGRGRR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR034201  RNPS1_RRM  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12365  RRM_RNPS1  
Amino Acid Sequences MPSRSPSPPRGRPRTRSPYSEASNPRPESQSPDRRRSISPRSASRSPRRNGRYRTDSRSRSPSPSRGRSPSPVRSTKVVIEKLTKNVNEDHLREIFGAYGQIRDLDMPINRNFNTNRGTAYILYTSEADAEAAIAHMHESQIDGAVINVSIVLPRRKFSPSPPLARRGANIDPRGPPSASFRPPPAPRRRSPPPSYGRPERNFDTYRPRSLSRSRSPRRHRTRSRSISSRSRSPPRRRGGRRDSPGRNGGRRRRSPSYSSYSSYDDRSRSRSRGRGGRGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.81
4 0.77
5 0.76
6 0.72
7 0.73
8 0.7
9 0.67
10 0.7
11 0.66
12 0.62
13 0.57
14 0.52
15 0.51
16 0.54
17 0.57
18 0.56
19 0.61
20 0.64
21 0.64
22 0.68
23 0.69
24 0.68
25 0.67
26 0.67
27 0.68
28 0.7
29 0.74
30 0.78
31 0.79
32 0.79
33 0.75
34 0.77
35 0.76
36 0.78
37 0.78
38 0.78
39 0.78
40 0.76
41 0.79
42 0.79
43 0.77
44 0.73
45 0.75
46 0.69
47 0.67
48 0.66
49 0.67
50 0.67
51 0.69
52 0.69
53 0.66
54 0.67
55 0.67
56 0.69
57 0.68
58 0.67
59 0.65
60 0.61
61 0.58
62 0.56
63 0.53
64 0.53
65 0.47
66 0.41
67 0.41
68 0.41
69 0.42
70 0.46
71 0.4
72 0.34
73 0.33
74 0.37
75 0.35
76 0.34
77 0.33
78 0.28
79 0.28
80 0.26
81 0.24
82 0.17
83 0.12
84 0.12
85 0.08
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.1
94 0.13
95 0.15
96 0.19
97 0.19
98 0.22
99 0.22
100 0.23
101 0.25
102 0.22
103 0.21
104 0.18
105 0.2
106 0.17
107 0.18
108 0.15
109 0.12
110 0.12
111 0.11
112 0.09
113 0.08
114 0.08
115 0.06
116 0.05
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.03
132 0.04
133 0.03
134 0.03
135 0.03
136 0.02
137 0.03
138 0.06
139 0.09
140 0.1
141 0.11
142 0.13
143 0.17
144 0.18
145 0.22
146 0.31
147 0.34
148 0.43
149 0.46
150 0.5
151 0.49
152 0.49
153 0.45
154 0.4
155 0.39
156 0.37
157 0.36
158 0.33
159 0.33
160 0.35
161 0.36
162 0.31
163 0.26
164 0.26
165 0.31
166 0.31
167 0.31
168 0.31
169 0.37
170 0.43
171 0.52
172 0.55
173 0.56
174 0.56
175 0.63
176 0.69
177 0.7
178 0.7
179 0.7
180 0.67
181 0.69
182 0.73
183 0.74
184 0.74
185 0.69
186 0.69
187 0.63
188 0.63
189 0.56
190 0.51
191 0.53
192 0.48
193 0.5
194 0.49
195 0.48
196 0.46
197 0.52
198 0.58
199 0.57
200 0.64
201 0.67
202 0.73
203 0.81
204 0.86
205 0.89
206 0.9
207 0.91
208 0.9
209 0.91
210 0.91
211 0.9
212 0.88
213 0.85
214 0.84
215 0.8
216 0.8
217 0.77
218 0.78
219 0.79
220 0.8
221 0.82
222 0.82
223 0.87
224 0.86
225 0.88
226 0.88
227 0.89
228 0.88
229 0.89
230 0.87
231 0.84
232 0.84
233 0.81
234 0.8
235 0.79
236 0.79
237 0.79
238 0.81
239 0.81
240 0.81
241 0.79
242 0.76
243 0.75
244 0.73
245 0.68
246 0.63
247 0.59
248 0.55
249 0.51
250 0.5
251 0.47
252 0.43
253 0.42
254 0.46
255 0.5
256 0.52
257 0.59
258 0.62
259 0.66
260 0.7
261 0.75