Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FZZ0

Protein Details
Accession I2FZZ0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
119-145DGGKEKATKAKKPKTQPKPAAKGTREQBasic
NLS Segment(s)
PositionSequence
63-152KKGAPSPKKWAVEKGERKDPSEPVGTPKTKKGGDEKAKDEPSEESGSKRKASTKAEDGGKEKATKAKKPKTQPKPAAKGTREQPKRSANK
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 8.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPQKREEARKEVLNMEKGGGKGQWSAWKASEMAKRYEAKGGDYEDTGDNANEAKKGAPSPKKWAVEKGERKDPSEPVGTPKTKKGGDEKAKDEPSEESGSKRKASTKAEDGGKEKATKAKKPKTQPKPAAKGTREQPKRSANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.72
4 0.66
5 0.67
6 0.65
7 0.62
8 0.58
9 0.53
10 0.45
11 0.39
12 0.36
13 0.31
14 0.29
15 0.23
16 0.18
17 0.15
18 0.17
19 0.23
20 0.22
21 0.24
22 0.23
23 0.24
24 0.24
25 0.29
26 0.32
27 0.28
28 0.29
29 0.33
30 0.34
31 0.33
32 0.38
33 0.31
34 0.27
35 0.27
36 0.27
37 0.22
38 0.2
39 0.21
40 0.16
41 0.16
42 0.15
43 0.11
44 0.09
45 0.08
46 0.09
47 0.07
48 0.07
49 0.07
50 0.07
51 0.1
52 0.18
53 0.24
54 0.26
55 0.34
56 0.41
57 0.45
58 0.45
59 0.49
60 0.48
61 0.51
62 0.57
63 0.54
64 0.56
65 0.53
66 0.54
67 0.5
68 0.45
69 0.38
70 0.32
71 0.28
72 0.24
73 0.3
74 0.31
75 0.3
76 0.32
77 0.34
78 0.32
79 0.34
80 0.35
81 0.39
82 0.45
83 0.5
84 0.51
85 0.54
86 0.55
87 0.52
88 0.47
89 0.38
90 0.33
91 0.31
92 0.27
93 0.23
94 0.27
95 0.3
96 0.31
97 0.31
98 0.32
99 0.35
100 0.4
101 0.43
102 0.44
103 0.48
104 0.51
105 0.54
106 0.51
107 0.49
108 0.47
109 0.41
110 0.37
111 0.37
112 0.38
113 0.42
114 0.5
115 0.56
116 0.61
117 0.7
118 0.8
119 0.83
120 0.88
121 0.9
122 0.9
123 0.89
124 0.9
125 0.9
126 0.81
127 0.79
128 0.77
129 0.77
130 0.75
131 0.7
132 0.69