Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6R8I7

Protein Details
Accession A0A2J6R8I7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-125EFPGKRRQEPVPKVKRSPRQGEKENVMHydrophilic
NLS Segment(s)
PositionSequence
103-115KRRQEPVPKVKRS
Subcellular Location(s) mito 12.5, mito_nucl 12.166, nucl 10.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MQHQPHRSQSSFRKEEEKGVGLHAKFVCPVPSSNAIRQSSSSLKKIPTPECQKVPPEGAPCETERSEKENQIVRSIARKQKPVPSSIDQRKSSPADAEEFPGKRRQEPVPKVKRSPRQGEKENVMSGLITCCLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.57
4 0.5
5 0.4
6 0.39
7 0.43
8 0.35
9 0.39
10 0.32
11 0.27
12 0.25
13 0.25
14 0.23
15 0.18
16 0.19
17 0.18
18 0.26
19 0.29
20 0.33
21 0.4
22 0.38
23 0.38
24 0.37
25 0.37
26 0.37
27 0.37
28 0.36
29 0.31
30 0.31
31 0.35
32 0.4
33 0.4
34 0.42
35 0.46
36 0.49
37 0.5
38 0.52
39 0.49
40 0.46
41 0.44
42 0.38
43 0.33
44 0.28
45 0.26
46 0.24
47 0.23
48 0.24
49 0.22
50 0.2
51 0.18
52 0.21
53 0.22
54 0.22
55 0.25
56 0.27
57 0.27
58 0.27
59 0.27
60 0.23
61 0.26
62 0.32
63 0.35
64 0.33
65 0.37
66 0.38
67 0.45
68 0.47
69 0.44
70 0.44
71 0.42
72 0.49
73 0.53
74 0.59
75 0.53
76 0.52
77 0.54
78 0.5
79 0.46
80 0.38
81 0.31
82 0.26
83 0.25
84 0.27
85 0.27
86 0.26
87 0.26
88 0.3
89 0.3
90 0.29
91 0.33
92 0.38
93 0.43
94 0.52
95 0.61
96 0.65
97 0.71
98 0.78
99 0.83
100 0.84
101 0.82
102 0.83
103 0.83
104 0.82
105 0.82
106 0.82
107 0.79
108 0.76
109 0.68
110 0.57
111 0.47
112 0.38
113 0.3
114 0.24