Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QSD4

Protein Details
Accession A0A2J6QSD4    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
8-29GNTQKAIKCRWRRYYISRQLHAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 6, nucl 3, cyto 3, cyto_nucl 3, pero 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSVDELGNTQKAIKCRWRRYYISRQLHARSRILATFHVLIRLMRLLLWNSEGRCCQQLVDLLRYSHLMIQVSRVILLAFFNIILYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.53
4 0.62
5 0.66
6 0.71
7 0.77
8 0.82
9 0.82
10 0.81
11 0.77
12 0.74
13 0.72
14 0.72
15 0.67
16 0.57
17 0.49
18 0.41
19 0.37
20 0.31
21 0.26
22 0.21
23 0.19
24 0.18
25 0.16
26 0.14
27 0.12
28 0.11
29 0.11
30 0.08
31 0.06
32 0.07
33 0.07
34 0.07
35 0.1
36 0.11
37 0.11
38 0.13
39 0.14
40 0.14
41 0.15
42 0.15
43 0.13
44 0.13
45 0.17
46 0.19
47 0.23
48 0.24
49 0.22
50 0.23
51 0.24
52 0.22
53 0.19
54 0.18
55 0.15
56 0.13
57 0.16
58 0.18
59 0.17
60 0.16
61 0.15
62 0.12
63 0.11
64 0.11
65 0.09
66 0.06
67 0.06
68 0.06