Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S0H0

Protein Details
Accession A0A2J6S0H0    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-25RQTIKTHRQEREVHRPQQRKSTRBasic
71-101AAGIFKKKPKVDPRDKKQHRRREVREPTPEPBasic
NLS Segment(s)
PositionSequence
75-93FKKKPKVDPRDKKQHRRRE
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MARQTIKTHRQEREVHRPQQRKSTRISRAHETAHYYTAKEASSIQRPIREAPSGNDAQNPKSAKVKQTVSAAGIFKKKPKVDPRDKKQHRRREVREPTPEPDLLDGLRDGIESTRYALTTTARANFDDIYAGFSEKLAVSKNVNGAFVQELAEAAATLSAPLVDEKIETTITKDGKRKVEIVEIGKRVATLKKFVEKEAAKLKEAWKHWDELQNEYIELGIEVFGPEVFGEDAAGLKIRQKGYKREMELLELEHNARVGELDEEIEEFGSKILQKMKASEKELDAAAKKEQARLLQALIQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.82
5 0.79
6 0.81
7 0.8
8 0.73
9 0.72
10 0.73
11 0.73
12 0.74
13 0.75
14 0.72
15 0.7
16 0.7
17 0.65
18 0.61
19 0.54
20 0.5
21 0.45
22 0.38
23 0.33
24 0.31
25 0.27
26 0.21
27 0.22
28 0.22
29 0.28
30 0.34
31 0.35
32 0.38
33 0.39
34 0.43
35 0.43
36 0.42
37 0.36
38 0.33
39 0.37
40 0.35
41 0.34
42 0.36
43 0.33
44 0.31
45 0.35
46 0.34
47 0.29
48 0.34
49 0.37
50 0.36
51 0.42
52 0.43
53 0.42
54 0.45
55 0.45
56 0.39
57 0.4
58 0.36
59 0.33
60 0.35
61 0.33
62 0.33
63 0.39
64 0.4
65 0.44
66 0.52
67 0.59
68 0.64
69 0.74
70 0.78
71 0.82
72 0.9
73 0.92
74 0.92
75 0.92
76 0.91
77 0.91
78 0.88
79 0.88
80 0.88
81 0.86
82 0.86
83 0.8
84 0.72
85 0.66
86 0.59
87 0.48
88 0.39
89 0.3
90 0.2
91 0.16
92 0.13
93 0.08
94 0.08
95 0.07
96 0.06
97 0.06
98 0.07
99 0.06
100 0.08
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.12
107 0.14
108 0.16
109 0.16
110 0.17
111 0.17
112 0.17
113 0.16
114 0.14
115 0.11
116 0.09
117 0.09
118 0.09
119 0.08
120 0.07
121 0.08
122 0.07
123 0.08
124 0.07
125 0.08
126 0.09
127 0.1
128 0.14
129 0.14
130 0.15
131 0.14
132 0.13
133 0.12
134 0.12
135 0.1
136 0.07
137 0.06
138 0.05
139 0.05
140 0.04
141 0.03
142 0.03
143 0.02
144 0.02
145 0.02
146 0.02
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.05
154 0.06
155 0.06
156 0.08
157 0.12
158 0.15
159 0.19
160 0.24
161 0.29
162 0.33
163 0.35
164 0.35
165 0.33
166 0.36
167 0.36
168 0.37
169 0.38
170 0.34
171 0.32
172 0.3
173 0.28
174 0.24
175 0.24
176 0.2
177 0.18
178 0.2
179 0.27
180 0.28
181 0.29
182 0.36
183 0.33
184 0.37
185 0.42
186 0.41
187 0.34
188 0.36
189 0.39
190 0.37
191 0.39
192 0.4
193 0.33
194 0.33
195 0.36
196 0.4
197 0.37
198 0.35
199 0.36
200 0.3
201 0.28
202 0.25
203 0.21
204 0.14
205 0.12
206 0.08
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.05
216 0.05
217 0.05
218 0.04
219 0.05
220 0.05
221 0.06
222 0.05
223 0.09
224 0.15
225 0.18
226 0.24
227 0.29
228 0.38
229 0.46
230 0.55
231 0.55
232 0.58
233 0.56
234 0.54
235 0.5
236 0.44
237 0.38
238 0.31
239 0.27
240 0.2
241 0.19
242 0.15
243 0.13
244 0.1
245 0.08
246 0.08
247 0.07
248 0.08
249 0.08
250 0.08
251 0.09
252 0.08
253 0.08
254 0.07
255 0.06
256 0.08
257 0.08
258 0.11
259 0.17
260 0.22
261 0.24
262 0.3
263 0.4
264 0.45
265 0.49
266 0.51
267 0.47
268 0.45
269 0.45
270 0.44
271 0.38
272 0.32
273 0.31
274 0.33
275 0.32
276 0.33
277 0.35
278 0.34
279 0.36
280 0.36
281 0.36