Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RWP6

Protein Details
Accession A0A2J6RWP6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MHHSFTRNRQKKRSIPHRARPSHQQNPKRNKLLLHydrophilic
NLS Segment(s)
PositionSequence
9-22RQKKRSIPHRARPS
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHHSFTRNRQKKRSIPHRARPSHQQNPKRNKLLLATSLFLSFLFDFKASLGKLETKAPIHAFTLHPRLLKRGIPNASPRIVRFSRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.9
5 0.87
6 0.84
7 0.84
8 0.82
9 0.81
10 0.8
11 0.8
12 0.79
13 0.82
14 0.86
15 0.81
16 0.72
17 0.65
18 0.58
19 0.53
20 0.48
21 0.4
22 0.32
23 0.26
24 0.25
25 0.22
26 0.18
27 0.15
28 0.09
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.09
35 0.07
36 0.08
37 0.09
38 0.11
39 0.12
40 0.14
41 0.17
42 0.15
43 0.18
44 0.19
45 0.19
46 0.18
47 0.2
48 0.2
49 0.22
50 0.28
51 0.28
52 0.29
53 0.28
54 0.31
55 0.33
56 0.35
57 0.36
58 0.39
59 0.4
60 0.43
61 0.5
62 0.51
63 0.53
64 0.51
65 0.47
66 0.46
67 0.44