Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6SDB5

Protein Details
Accession A0A2J6SDB5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-92AIAELKRRLKSKPKPKNKPDYQQDDGTHydrophilic
NLS Segment(s)
PositionSequence
71-83KRRLKSKPKPKNK
153-161KKRKARARG
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MSPRSDIFLSLCLAQAELSPLHYRHGSIIVRGGKVIGQGFNCYRPGFDGGALKSGVLPSASLDGPAIAELKRRLKSKPKPKNKPDYQQDDGTFTPFESTGCGPNANVHLSMHSEMMAIRSALSLSSGTLSSQTSAGSAKCFEKPCFKLPGDSKKRKARARGLKAYAAAVCAEAEASGTSKSYGGKFSIQKSGFEPGSSQSGLQGGRQQVQRQGGEAVRGLEHMEKCRETPTEEVWPPKKPPSLAPKPQQILITKKNSLNTKADVKERTKDFRLKGSDLYVARLGMCQITPPLDLKLKQHASKIAAPASSSSPRSEPASLYDELSQLSRTPSPSTSPPNPPPILKPEVRASRPCYRCVSAMHAVGIKRVFWTNADGEWEGAKVRDLVDALEKGIEGDGDGTGTGQENKGVFVTKHEVLMLKRIMGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.14
6 0.17
7 0.18
8 0.21
9 0.22
10 0.22
11 0.21
12 0.29
13 0.27
14 0.25
15 0.32
16 0.34
17 0.33
18 0.33
19 0.31
20 0.24
21 0.26
22 0.26
23 0.22
24 0.18
25 0.23
26 0.26
27 0.29
28 0.31
29 0.28
30 0.25
31 0.24
32 0.27
33 0.23
34 0.23
35 0.26
36 0.24
37 0.28
38 0.27
39 0.24
40 0.21
41 0.2
42 0.17
43 0.11
44 0.1
45 0.07
46 0.11
47 0.11
48 0.1
49 0.1
50 0.09
51 0.09
52 0.1
53 0.1
54 0.07
55 0.12
56 0.17
57 0.25
58 0.3
59 0.33
60 0.39
61 0.49
62 0.59
63 0.66
64 0.72
65 0.76
66 0.82
67 0.9
68 0.94
69 0.93
70 0.93
71 0.92
72 0.9
73 0.84
74 0.8
75 0.71
76 0.64
77 0.54
78 0.45
79 0.35
80 0.26
81 0.22
82 0.15
83 0.13
84 0.12
85 0.13
86 0.14
87 0.15
88 0.16
89 0.14
90 0.17
91 0.2
92 0.19
93 0.18
94 0.15
95 0.14
96 0.17
97 0.18
98 0.14
99 0.12
100 0.1
101 0.1
102 0.11
103 0.1
104 0.08
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.06
111 0.05
112 0.07
113 0.06
114 0.06
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.11
125 0.13
126 0.18
127 0.21
128 0.23
129 0.3
130 0.34
131 0.38
132 0.43
133 0.41
134 0.44
135 0.48
136 0.57
137 0.59
138 0.64
139 0.68
140 0.7
141 0.78
142 0.76
143 0.78
144 0.77
145 0.78
146 0.79
147 0.79
148 0.74
149 0.69
150 0.63
151 0.56
152 0.46
153 0.35
154 0.25
155 0.15
156 0.11
157 0.07
158 0.06
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.05
166 0.06
167 0.07
168 0.08
169 0.1
170 0.11
171 0.16
172 0.2
173 0.22
174 0.3
175 0.3
176 0.3
177 0.3
178 0.33
179 0.27
180 0.24
181 0.22
182 0.14
183 0.17
184 0.16
185 0.14
186 0.1
187 0.12
188 0.12
189 0.12
190 0.15
191 0.13
192 0.17
193 0.19
194 0.2
195 0.22
196 0.26
197 0.26
198 0.22
199 0.24
200 0.19
201 0.19
202 0.18
203 0.14
204 0.1
205 0.1
206 0.1
207 0.11
208 0.12
209 0.13
210 0.15
211 0.15
212 0.15
213 0.18
214 0.18
215 0.16
216 0.18
217 0.19
218 0.24
219 0.26
220 0.32
221 0.32
222 0.35
223 0.35
224 0.38
225 0.37
226 0.3
227 0.35
228 0.39
229 0.47
230 0.52
231 0.56
232 0.59
233 0.58
234 0.59
235 0.56
236 0.5
237 0.47
238 0.46
239 0.45
240 0.41
241 0.42
242 0.44
243 0.44
244 0.44
245 0.4
246 0.37
247 0.38
248 0.38
249 0.41
250 0.42
251 0.42
252 0.44
253 0.45
254 0.48
255 0.46
256 0.49
257 0.46
258 0.48
259 0.51
260 0.46
261 0.43
262 0.4
263 0.4
264 0.33
265 0.34
266 0.26
267 0.21
268 0.19
269 0.17
270 0.15
271 0.1
272 0.09
273 0.07
274 0.07
275 0.08
276 0.09
277 0.1
278 0.13
279 0.16
280 0.18
281 0.2
282 0.29
283 0.33
284 0.35
285 0.37
286 0.39
287 0.4
288 0.42
289 0.44
290 0.37
291 0.31
292 0.29
293 0.28
294 0.28
295 0.27
296 0.24
297 0.22
298 0.2
299 0.22
300 0.25
301 0.25
302 0.21
303 0.21
304 0.24
305 0.23
306 0.24
307 0.23
308 0.2
309 0.19
310 0.19
311 0.15
312 0.11
313 0.14
314 0.14
315 0.15
316 0.17
317 0.18
318 0.22
319 0.27
320 0.34
321 0.38
322 0.45
323 0.49
324 0.54
325 0.55
326 0.53
327 0.52
328 0.5
329 0.51
330 0.44
331 0.42
332 0.43
333 0.5
334 0.53
335 0.54
336 0.54
337 0.58
338 0.59
339 0.59
340 0.56
341 0.5
342 0.49
343 0.46
344 0.47
345 0.42
346 0.41
347 0.39
348 0.37
349 0.34
350 0.34
351 0.32
352 0.24
353 0.2
354 0.2
355 0.19
356 0.16
357 0.21
358 0.19
359 0.2
360 0.24
361 0.22
362 0.21
363 0.21
364 0.2
365 0.16
366 0.14
367 0.14
368 0.1
369 0.1
370 0.12
371 0.11
372 0.12
373 0.17
374 0.17
375 0.17
376 0.17
377 0.16
378 0.14
379 0.14
380 0.12
381 0.07
382 0.07
383 0.06
384 0.06
385 0.06
386 0.06
387 0.06
388 0.08
389 0.1
390 0.09
391 0.13
392 0.13
393 0.14
394 0.15
395 0.18
396 0.17
397 0.21
398 0.27
399 0.25
400 0.26
401 0.27
402 0.29
403 0.27
404 0.35
405 0.32