Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RJF4

Protein Details
Accession A0A2J6RJF4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-69SDFANSRRQRREHRKGHRGGRTPTBasic
103-128GKSSRNRKPLTKAKARSRRKMQIVVCHydrophilic
NLS Segment(s)
PositionSequence
52-83RRQRREHRKGHRGGRTPTGKSKTHVKHAPSSG
86-122SKQTSRDHHGHARNGHSGKSSRNRKPLTKAKARSRRK
Subcellular Location(s) mito 12, extr 4, plas 3, nucl 2.5, cyto_nucl 2.5, cyto 1.5, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPKTSHNRASSLQLPSNVHCRPEIINLETLSASPVLDEEEQIGRDSDFANSRRQRREHRKGHRGGRTPTGKSKTHVKHAPSSGTTSKQTSRDHHGHARNGHSGKSSRNRKPLTKAKARSRRKMQIVVCWVFGLSILLLVVMLLAIFAMSGKGNGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.49
4 0.44
5 0.39
6 0.32
7 0.3
8 0.27
9 0.31
10 0.34
11 0.28
12 0.31
13 0.29
14 0.3
15 0.28
16 0.26
17 0.2
18 0.15
19 0.11
20 0.07
21 0.07
22 0.08
23 0.08
24 0.08
25 0.09
26 0.1
27 0.11
28 0.12
29 0.12
30 0.09
31 0.1
32 0.1
33 0.11
34 0.14
35 0.15
36 0.24
37 0.31
38 0.37
39 0.44
40 0.5
41 0.58
42 0.64
43 0.73
44 0.74
45 0.79
46 0.82
47 0.84
48 0.87
49 0.85
50 0.82
51 0.74
52 0.73
53 0.68
54 0.61
55 0.6
56 0.57
57 0.49
58 0.44
59 0.5
60 0.45
61 0.47
62 0.49
63 0.44
64 0.45
65 0.46
66 0.47
67 0.38
68 0.39
69 0.33
70 0.31
71 0.29
72 0.25
73 0.26
74 0.29
75 0.31
76 0.3
77 0.35
78 0.37
79 0.4
80 0.46
81 0.49
82 0.49
83 0.49
84 0.5
85 0.49
86 0.45
87 0.41
88 0.37
89 0.33
90 0.35
91 0.41
92 0.47
93 0.47
94 0.56
95 0.6
96 0.63
97 0.71
98 0.73
99 0.73
100 0.73
101 0.75
102 0.77
103 0.82
104 0.85
105 0.86
106 0.86
107 0.86
108 0.83
109 0.83
110 0.75
111 0.74
112 0.74
113 0.66
114 0.56
115 0.47
116 0.39
117 0.3
118 0.26
119 0.17
120 0.08
121 0.06
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.03
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.03
135 0.04