Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FPE4

Protein Details
Accession I2FPE4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-106IMAHKMSAKKLARKKRRLGITKKVSHAHydrophilic
NLS Segment(s)
PositionSequence
32-103KKLEQRRKQEAIKQREREMKAEKEAEAERKKTVSRERKQMAEEKARLEIMAHKMSAKKLARKKRRLGITKKV
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MCGSSSDMLPVKPTSRTRVTLAGKQKTILWEKKLEQRRKQEAIKQREREMKAEKEAEAERKKTVSRERKQMAEEKARLEIMAHKMSAKKLARKKRRLGITKKVSHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.4
4 0.4
5 0.47
6 0.5
7 0.51
8 0.57
9 0.57
10 0.52
11 0.49
12 0.48
13 0.45
14 0.48
15 0.46
16 0.4
17 0.39
18 0.42
19 0.5
20 0.58
21 0.61
22 0.61
23 0.66
24 0.7
25 0.71
26 0.73
27 0.72
28 0.72
29 0.73
30 0.74
31 0.68
32 0.66
33 0.67
34 0.64
35 0.61
36 0.57
37 0.5
38 0.45
39 0.42
40 0.36
41 0.31
42 0.31
43 0.33
44 0.31
45 0.29
46 0.25
47 0.25
48 0.26
49 0.29
50 0.37
51 0.4
52 0.43
53 0.52
54 0.55
55 0.57
56 0.6
57 0.62
58 0.6
59 0.58
60 0.54
61 0.46
62 0.44
63 0.4
64 0.36
65 0.29
66 0.27
67 0.23
68 0.23
69 0.22
70 0.22
71 0.24
72 0.26
73 0.34
74 0.34
75 0.38
76 0.45
77 0.56
78 0.65
79 0.72
80 0.81
81 0.81
82 0.86
83 0.87
84 0.87
85 0.87
86 0.87