Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RK53

Protein Details
Accession A0A2J6RK53    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
254-285KNGTMDPEERKRMKKREKRKRQKERLKAAGKVBasic
NLS Segment(s)
PositionSequence
133-142GLGRAKKRKT
263-285RKRMKKREKRKRQKERLKAAGKV
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MEPDESKPVKVSKENFDVISNRIAVALAKREALIKSWTASSSRQRSPEKTEAELEAEDAALFRNEPPYLGVGAPIPSHFLVSEAERNNKSLRAKFFPSKTLKASKARDAEEKAASAKRGLKDDSSDEEEGRSGLGRAKKRKTLKTEPVKEDGKELVDHAMDEDDSKLPKAQAKVVDHNTKAGKADKRVLKTQDTSIRPATNAGKDNANSARGEKRIQSLAAPLKDNSDADDSDSGDDLAGKKGTSRSVPAMLQKNGTMDPEERKRMKKREKRKRQKERLKAAGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.5
4 0.46
5 0.41
6 0.4
7 0.31
8 0.24
9 0.21
10 0.19
11 0.16
12 0.18
13 0.21
14 0.18
15 0.18
16 0.18
17 0.21
18 0.22
19 0.23
20 0.22
21 0.19
22 0.19
23 0.21
24 0.22
25 0.22
26 0.27
27 0.34
28 0.39
29 0.43
30 0.49
31 0.54
32 0.57
33 0.64
34 0.66
35 0.61
36 0.56
37 0.53
38 0.47
39 0.43
40 0.38
41 0.3
42 0.21
43 0.17
44 0.13
45 0.1
46 0.08
47 0.06
48 0.06
49 0.06
50 0.09
51 0.09
52 0.09
53 0.1
54 0.11
55 0.13
56 0.12
57 0.12
58 0.1
59 0.11
60 0.11
61 0.1
62 0.11
63 0.1
64 0.1
65 0.09
66 0.09
67 0.1
68 0.12
69 0.19
70 0.19
71 0.25
72 0.25
73 0.27
74 0.28
75 0.31
76 0.33
77 0.33
78 0.35
79 0.36
80 0.41
81 0.46
82 0.48
83 0.52
84 0.53
85 0.52
86 0.51
87 0.52
88 0.52
89 0.54
90 0.55
91 0.54
92 0.53
93 0.52
94 0.52
95 0.48
96 0.46
97 0.39
98 0.36
99 0.31
100 0.27
101 0.24
102 0.21
103 0.22
104 0.2
105 0.22
106 0.22
107 0.21
108 0.21
109 0.24
110 0.25
111 0.25
112 0.24
113 0.21
114 0.2
115 0.19
116 0.17
117 0.14
118 0.1
119 0.06
120 0.08
121 0.14
122 0.2
123 0.27
124 0.32
125 0.39
126 0.47
127 0.54
128 0.59
129 0.63
130 0.67
131 0.71
132 0.76
133 0.72
134 0.71
135 0.66
136 0.57
137 0.49
138 0.4
139 0.3
140 0.21
141 0.18
142 0.13
143 0.11
144 0.1
145 0.08
146 0.07
147 0.06
148 0.06
149 0.07
150 0.07
151 0.07
152 0.08
153 0.08
154 0.09
155 0.13
156 0.14
157 0.17
158 0.22
159 0.27
160 0.34
161 0.4
162 0.45
163 0.42
164 0.45
165 0.42
166 0.36
167 0.34
168 0.33
169 0.3
170 0.28
171 0.36
172 0.37
173 0.4
174 0.46
175 0.48
176 0.46
177 0.45
178 0.48
179 0.49
180 0.46
181 0.45
182 0.43
183 0.4
184 0.35
185 0.36
186 0.33
187 0.3
188 0.31
189 0.28
190 0.28
191 0.27
192 0.32
193 0.3
194 0.28
195 0.23
196 0.23
197 0.26
198 0.24
199 0.27
200 0.24
201 0.26
202 0.27
203 0.27
204 0.25
205 0.28
206 0.33
207 0.34
208 0.34
209 0.3
210 0.29
211 0.31
212 0.29
213 0.25
214 0.2
215 0.17
216 0.18
217 0.19
218 0.17
219 0.17
220 0.17
221 0.14
222 0.11
223 0.12
224 0.1
225 0.12
226 0.12
227 0.1
228 0.13
229 0.15
230 0.19
231 0.21
232 0.24
233 0.26
234 0.3
235 0.33
236 0.39
237 0.44
238 0.43
239 0.42
240 0.39
241 0.37
242 0.34
243 0.32
244 0.27
245 0.23
246 0.29
247 0.35
248 0.44
249 0.47
250 0.55
251 0.63
252 0.71
253 0.79
254 0.81
255 0.84
256 0.86
257 0.92
258 0.94
259 0.96
260 0.96
261 0.97
262 0.97
263 0.97
264 0.96
265 0.96