Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RRY5

Protein Details
Accession A0A2J6RRY5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-115TPSLRTIRRAPTNRRPQTRSSQPSARPRDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MSDLDTDAALLHHVPSGHSTSSMPPLICISRLDPTATSIKSGSRLSLHASGFPERSRFRAPHCAYQSPPLPHHQQTPLSVYHQRLTPSLRTIRRAPTNRRPQTRSSQPSARPRDTPSPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.14
4 0.14
5 0.15
6 0.16
7 0.17
8 0.22
9 0.24
10 0.21
11 0.18
12 0.21
13 0.21
14 0.21
15 0.2
16 0.17
17 0.17
18 0.18
19 0.19
20 0.16
21 0.18
22 0.22
23 0.21
24 0.2
25 0.17
26 0.17
27 0.2
28 0.2
29 0.18
30 0.14
31 0.15
32 0.17
33 0.22
34 0.21
35 0.2
36 0.22
37 0.22
38 0.22
39 0.22
40 0.22
41 0.18
42 0.21
43 0.23
44 0.22
45 0.24
46 0.34
47 0.36
48 0.41
49 0.45
50 0.44
51 0.41
52 0.45
53 0.47
54 0.39
55 0.38
56 0.34
57 0.34
58 0.32
59 0.36
60 0.35
61 0.31
62 0.3
63 0.32
64 0.29
65 0.28
66 0.3
67 0.28
68 0.27
69 0.26
70 0.26
71 0.25
72 0.27
73 0.26
74 0.29
75 0.35
76 0.37
77 0.39
78 0.42
79 0.48
80 0.55
81 0.6
82 0.63
83 0.66
84 0.73
85 0.78
86 0.83
87 0.8
88 0.76
89 0.78
90 0.79
91 0.76
92 0.73
93 0.72
94 0.72
95 0.78
96 0.8
97 0.75
98 0.68
99 0.68