Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2FY21

Protein Details
Accession I2FY21    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-33DTKTKSSTSTQKRTTKSKKDPAAPKRPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAKADTKTKSSTSTQKRTTKSKKDPAAPKRPLSAYMFFSQDQRERVKADNPEAGFGDVGRLLGARWKEMSDAEKKPYNDMANRDKARAEAEKAAFAKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.71
4 0.77
5 0.81
6 0.82
7 0.82
8 0.83
9 0.81
10 0.83
11 0.87
12 0.86
13 0.87
14 0.83
15 0.76
16 0.71
17 0.64
18 0.58
19 0.52
20 0.45
21 0.38
22 0.33
23 0.32
24 0.27
25 0.27
26 0.26
27 0.25
28 0.24
29 0.23
30 0.22
31 0.22
32 0.23
33 0.27
34 0.27
35 0.27
36 0.28
37 0.26
38 0.25
39 0.24
40 0.22
41 0.17
42 0.13
43 0.11
44 0.06
45 0.06
46 0.05
47 0.04
48 0.04
49 0.07
50 0.08
51 0.08
52 0.09
53 0.1
54 0.11
55 0.13
56 0.17
57 0.21
58 0.24
59 0.28
60 0.34
61 0.34
62 0.36
63 0.4
64 0.41
65 0.39
66 0.43
67 0.47
68 0.51
69 0.52
70 0.51
71 0.46
72 0.42
73 0.42
74 0.4
75 0.36
76 0.34
77 0.34
78 0.39
79 0.4