Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RTB4

Protein Details
Accession A0A2J6RTB4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MDPESATKRRKIRKGTHSCWECKRRKLRCLFEHGSHydrophilic
NLS Segment(s)
PositionSequence
10-11RK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MDPESATKRRKIRKGTHSCWECKRRKLRCLFEHGSPANAICIGCRRRGTSCVSQEFPEEVSAPIEKARHMRDRVVRVEDQLEELIRKVGKDEPAVSERPFSEETPNFGMLYPASTDSESSRFSVSRQTSEVCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.85
4 0.83
5 0.81
6 0.81
7 0.82
8 0.78
9 0.77
10 0.81
11 0.79
12 0.81
13 0.84
14 0.84
15 0.81
16 0.83
17 0.77
18 0.71
19 0.71
20 0.62
21 0.53
22 0.43
23 0.35
24 0.25
25 0.22
26 0.17
27 0.09
28 0.16
29 0.16
30 0.2
31 0.22
32 0.24
33 0.25
34 0.29
35 0.35
36 0.36
37 0.41
38 0.43
39 0.42
40 0.4
41 0.39
42 0.36
43 0.3
44 0.22
45 0.16
46 0.11
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.12
54 0.16
55 0.21
56 0.23
57 0.28
58 0.33
59 0.39
60 0.42
61 0.43
62 0.39
63 0.34
64 0.34
65 0.29
66 0.24
67 0.19
68 0.15
69 0.11
70 0.1
71 0.11
72 0.1
73 0.09
74 0.1
75 0.13
76 0.16
77 0.18
78 0.19
79 0.21
80 0.25
81 0.27
82 0.26
83 0.25
84 0.22
85 0.24
86 0.25
87 0.21
88 0.26
89 0.25
90 0.29
91 0.3
92 0.31
93 0.27
94 0.25
95 0.25
96 0.17
97 0.17
98 0.14
99 0.12
100 0.12
101 0.12
102 0.13
103 0.15
104 0.18
105 0.18
106 0.18
107 0.19
108 0.18
109 0.19
110 0.27
111 0.28
112 0.3
113 0.31