Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RJZ3

Protein Details
Accession A0A2J6RJZ3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-182STEVSVPKLPKRRKPWEKDLPEDVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MSTETTPTTENVEIYRQLEEYPWDTDKEFQIGLSAILGPNPSQSQLYDLTLRAQCYYLARKKSVPIDFEGYKTYLSSKSSSTPNQPPTIKSPSTQPEPTSQPTTSPSQPAEMSLGNTAQEPEAPPKTAPYPPTFAQIVAMITSGEPIPGIMEIPDTISTEVSVPKLPKRRKPWEKDLPEDVIQGRSGGTFGDHRDEYIKQELPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.19
4 0.18
5 0.19
6 0.2
7 0.19
8 0.21
9 0.21
10 0.21
11 0.22
12 0.25
13 0.25
14 0.24
15 0.22
16 0.17
17 0.17
18 0.15
19 0.14
20 0.12
21 0.11
22 0.08
23 0.08
24 0.09
25 0.07
26 0.09
27 0.1
28 0.1
29 0.1
30 0.1
31 0.13
32 0.14
33 0.17
34 0.17
35 0.17
36 0.21
37 0.22
38 0.23
39 0.2
40 0.19
41 0.18
42 0.2
43 0.28
44 0.3
45 0.32
46 0.34
47 0.35
48 0.39
49 0.46
50 0.47
51 0.4
52 0.37
53 0.38
54 0.36
55 0.36
56 0.33
57 0.26
58 0.22
59 0.2
60 0.18
61 0.14
62 0.15
63 0.15
64 0.14
65 0.17
66 0.22
67 0.24
68 0.29
69 0.34
70 0.37
71 0.41
72 0.41
73 0.4
74 0.41
75 0.44
76 0.39
77 0.32
78 0.34
79 0.32
80 0.37
81 0.36
82 0.32
83 0.3
84 0.33
85 0.36
86 0.34
87 0.29
88 0.24
89 0.25
90 0.28
91 0.24
92 0.23
93 0.2
94 0.18
95 0.18
96 0.17
97 0.17
98 0.13
99 0.13
100 0.11
101 0.11
102 0.09
103 0.09
104 0.08
105 0.06
106 0.07
107 0.07
108 0.11
109 0.12
110 0.13
111 0.13
112 0.15
113 0.18
114 0.2
115 0.22
116 0.21
117 0.25
118 0.24
119 0.28
120 0.27
121 0.24
122 0.21
123 0.19
124 0.16
125 0.12
126 0.11
127 0.07
128 0.06
129 0.07
130 0.06
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.06
141 0.07
142 0.08
143 0.08
144 0.08
145 0.09
146 0.09
147 0.1
148 0.1
149 0.13
150 0.15
151 0.22
152 0.31
153 0.39
154 0.48
155 0.57
156 0.67
157 0.74
158 0.81
159 0.85
160 0.86
161 0.87
162 0.85
163 0.81
164 0.76
165 0.66
166 0.6
167 0.5
168 0.41
169 0.33
170 0.26
171 0.2
172 0.14
173 0.12
174 0.09
175 0.1
176 0.11
177 0.13
178 0.19
179 0.19
180 0.2
181 0.23
182 0.24
183 0.27
184 0.31
185 0.33