Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QUN4

Protein Details
Accession A0A2J6QUN4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKHVRRFKQKIESRREKGVEBasic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031359  NACHT_N  
Pfam View protein in Pfam  
PF17100  NACHT_N  
Amino Acid Sequences MKHVRRFKQKIESRREKGVEQGGEGSCSPASATADQVSTSPLVPTSTSTVSDPQSPNHLPTMMLSIPLAHQLTVSATPSTSESPDLWKMAYDKFRIEEPDLLGDYDKHILGDAAVNPDLSSRESIETALNKLLEDREKKQWKVSVLGHDIKIRAHVERLTNILKWSDPLVKQAVSTQPYAALAWSGVSLLLPLLTSGTTQNEAMLEGFNSIGELQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.68
4 0.66
5 0.64
6 0.55
7 0.46
8 0.46
9 0.36
10 0.34
11 0.33
12 0.27
13 0.18
14 0.16
15 0.14
16 0.11
17 0.13
18 0.11
19 0.14
20 0.13
21 0.14
22 0.14
23 0.15
24 0.14
25 0.12
26 0.12
27 0.1
28 0.09
29 0.09
30 0.09
31 0.11
32 0.14
33 0.14
34 0.16
35 0.17
36 0.19
37 0.2
38 0.26
39 0.25
40 0.23
41 0.28
42 0.28
43 0.29
44 0.27
45 0.26
46 0.2
47 0.19
48 0.23
49 0.16
50 0.15
51 0.13
52 0.12
53 0.11
54 0.15
55 0.14
56 0.08
57 0.08
58 0.08
59 0.1
60 0.1
61 0.11
62 0.08
63 0.08
64 0.08
65 0.1
66 0.11
67 0.1
68 0.11
69 0.1
70 0.14
71 0.15
72 0.15
73 0.14
74 0.14
75 0.15
76 0.18
77 0.22
78 0.19
79 0.19
80 0.19
81 0.21
82 0.22
83 0.23
84 0.2
85 0.17
86 0.18
87 0.17
88 0.16
89 0.15
90 0.12
91 0.11
92 0.1
93 0.09
94 0.06
95 0.06
96 0.05
97 0.05
98 0.07
99 0.06
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.08
107 0.08
108 0.07
109 0.08
110 0.08
111 0.09
112 0.11
113 0.12
114 0.12
115 0.13
116 0.12
117 0.11
118 0.11
119 0.13
120 0.16
121 0.19
122 0.22
123 0.31
124 0.38
125 0.39
126 0.44
127 0.46
128 0.42
129 0.45
130 0.45
131 0.43
132 0.42
133 0.45
134 0.42
135 0.4
136 0.38
137 0.32
138 0.31
139 0.24
140 0.19
141 0.18
142 0.19
143 0.2
144 0.21
145 0.25
146 0.24
147 0.24
148 0.24
149 0.22
150 0.19
151 0.18
152 0.19
153 0.21
154 0.19
155 0.22
156 0.24
157 0.23
158 0.23
159 0.26
160 0.3
161 0.26
162 0.26
163 0.23
164 0.21
165 0.21
166 0.21
167 0.17
168 0.11
169 0.08
170 0.08
171 0.07
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.05
182 0.06
183 0.07
184 0.1
185 0.12
186 0.12
187 0.13
188 0.13
189 0.13
190 0.13
191 0.13
192 0.1
193 0.09
194 0.09
195 0.08
196 0.08
197 0.08