Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2G6X9

Protein Details
Accession I2G6X9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-61EFTITPSWNKKRRRGEARKFGVIHHydrophilic
NLS Segment(s)
PositionSequence
47-71KKRRRGEARKFGVIHRGGPRAKMGK
109-123VSKKGETRRKKKVAA
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTFSGHAGWEPRREKLSVAKDSKSQGSAKVCEDPVNEEFTITPSWNKKRRRGEARKFGVIHRGGPRAKMGKPAVDLCVSNLLSTHSFCSRPFGASRKQQEARNSKQEAVSKKGETRRKKKVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.47
4 0.48
5 0.5
6 0.49
7 0.5
8 0.53
9 0.53
10 0.47
11 0.39
12 0.35
13 0.35
14 0.35
15 0.34
16 0.35
17 0.33
18 0.32
19 0.31
20 0.3
21 0.26
22 0.27
23 0.24
24 0.19
25 0.18
26 0.18
27 0.18
28 0.14
29 0.16
30 0.19
31 0.28
32 0.36
33 0.43
34 0.5
35 0.59
36 0.69
37 0.76
38 0.8
39 0.82
40 0.85
41 0.84
42 0.82
43 0.73
44 0.63
45 0.6
46 0.49
47 0.43
48 0.36
49 0.35
50 0.29
51 0.29
52 0.31
53 0.27
54 0.27
55 0.3
56 0.28
57 0.25
58 0.27
59 0.28
60 0.26
61 0.24
62 0.23
63 0.16
64 0.21
65 0.18
66 0.15
67 0.14
68 0.14
69 0.14
70 0.14
71 0.16
72 0.13
73 0.14
74 0.14
75 0.19
76 0.19
77 0.2
78 0.23
79 0.26
80 0.32
81 0.4
82 0.47
83 0.51
84 0.55
85 0.57
86 0.64
87 0.68
88 0.69
89 0.69
90 0.66
91 0.59
92 0.6
93 0.61
94 0.57
95 0.54
96 0.51
97 0.46
98 0.5
99 0.56
100 0.61
101 0.65
102 0.69
103 0.74