Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RET6

Protein Details
Accession A0A2J6RET6    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAAKPPKRRNERLSRRKSTLIHHydrophilic
NLS Segment(s)
PositionSequence
4-17KPPKRRNERLSRRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MAAKPPKRRNERLSRRKSTLIHKAHELARFCDVDVALIMRNRQTGRYFTYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.81
4 0.75
5 0.73
6 0.71
7 0.67
8 0.58
9 0.52
10 0.51
11 0.48
12 0.48
13 0.4
14 0.31
15 0.28
16 0.26
17 0.23
18 0.21
19 0.17
20 0.12
21 0.11
22 0.11
23 0.1
24 0.11
25 0.12
26 0.11
27 0.16
28 0.16
29 0.19
30 0.22
31 0.24
32 0.3