Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RCT3

Protein Details
Accession A0A2J6RCT3    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-27PKSANRFWLSWRRRRPREVMCRNSEFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 11, nucl 4.5, plas 3
Family & Domain DBs
Amino Acid Sequences MPKSANRFWLSWRRRRPREVMCRNSEFGKGFLGHSEGIRDAEVEIMDGESGNWLVELKKWGLFVDSVIYCFMLLWTSFELAGNSKGAEAAMKYTVSAYRIDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.82
4 0.82
5 0.85
6 0.86
7 0.84
8 0.82
9 0.78
10 0.73
11 0.66
12 0.58
13 0.48
14 0.38
15 0.31
16 0.23
17 0.19
18 0.17
19 0.17
20 0.14
21 0.13
22 0.13
23 0.11
24 0.1
25 0.1
26 0.09
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.05
43 0.07
44 0.08
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.09
51 0.12
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.09
59 0.06
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.1
67 0.1
68 0.12
69 0.11
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.09
77 0.11
78 0.11
79 0.11
80 0.12
81 0.15
82 0.15