Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6S7W5

Protein Details
Accession A0A2J6S7W5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VSNTSIPRRTVRQRRKKAPKPHLISLGHydrophilic
NLS Segment(s)
PositionSequence
22-64RRTVRQRRKKAPKPHLISLGIKVSARTIRRELRRVGYQRSKKR
Subcellular Location(s) mito 15.5, mito_nucl 13.166, nucl 9.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MSDGLIFRKSQREIVSNTSIPRRTVRQRRKKAPKPHLISLGIKVSARTIRRELRRVGYQRSKKRLGFALKYRWWGISDYTTFRIWVTRRIDEKRYISYMRSVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.43
4 0.45
5 0.46
6 0.44
7 0.41
8 0.41
9 0.41
10 0.45
11 0.53
12 0.61
13 0.65
14 0.73
15 0.83
16 0.9
17 0.93
18 0.93
19 0.93
20 0.92
21 0.88
22 0.84
23 0.79
24 0.72
25 0.64
26 0.56
27 0.48
28 0.38
29 0.3
30 0.24
31 0.19
32 0.19
33 0.19
34 0.19
35 0.21
36 0.27
37 0.33
38 0.37
39 0.38
40 0.39
41 0.46
42 0.47
43 0.5
44 0.53
45 0.57
46 0.62
47 0.67
48 0.68
49 0.61
50 0.62
51 0.61
52 0.58
53 0.57
54 0.55
55 0.58
56 0.55
57 0.57
58 0.54
59 0.48
60 0.41
61 0.34
62 0.3
63 0.26
64 0.25
65 0.26
66 0.27
67 0.27
68 0.26
69 0.24
70 0.28
71 0.23
72 0.28
73 0.3
74 0.35
75 0.42
76 0.48
77 0.54
78 0.57
79 0.6
80 0.59
81 0.59
82 0.53
83 0.48