Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6R2R0

Protein Details
Accession A0A2J6R2R0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-114DERNWSYYPKRKEGPRNKLKGRBasic
NLS Segment(s)
PositionSequence
102-114KRKEGPRNKLKGR
Subcellular Location(s) nucl 12, cyto 10, mito 2, pero 1, E.R. 1, cysk 1
Family & Domain DBs
Amino Acid Sequences MLFEHLDIVTATCLGLTNKHLYSILKSIHKGPIRLFGTVDISLPGVPTVSKFIFTPLQLLISKWIEPLVWAGHMDRYRFVTRQRLRELVAEEDERNWSYYPKRKEGPRNKLKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.17
5 0.17
6 0.18
7 0.2
8 0.2
9 0.23
10 0.27
11 0.29
12 0.28
13 0.29
14 0.31
15 0.38
16 0.4
17 0.38
18 0.34
19 0.38
20 0.36
21 0.35
22 0.32
23 0.25
24 0.26
25 0.24
26 0.22
27 0.13
28 0.11
29 0.1
30 0.1
31 0.08
32 0.05
33 0.04
34 0.05
35 0.08
36 0.08
37 0.08
38 0.08
39 0.11
40 0.13
41 0.13
42 0.14
43 0.11
44 0.13
45 0.13
46 0.13
47 0.14
48 0.13
49 0.13
50 0.11
51 0.11
52 0.08
53 0.08
54 0.1
55 0.07
56 0.07
57 0.07
58 0.08
59 0.12
60 0.15
61 0.15
62 0.15
63 0.19
64 0.22
65 0.23
66 0.27
67 0.33
68 0.37
69 0.45
70 0.5
71 0.48
72 0.47
73 0.49
74 0.48
75 0.42
76 0.4
77 0.34
78 0.29
79 0.27
80 0.28
81 0.24
82 0.23
83 0.19
84 0.19
85 0.25
86 0.33
87 0.4
88 0.45
89 0.52
90 0.6
91 0.7
92 0.78
93 0.81
94 0.83