Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S895

Protein Details
Accession A0A2J6S895    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-37QPTSDEKGAKKRQYQKEKKERARERKRKAEGEABasic
NLS Segment(s)
PositionSequence
11-33KGAKKRQYQKEKKERARERKRKA
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MSPNQPTSDEKGAKKRQYQKEKKERARERKRKAEGEAEEEAEALVAAPAAKSEYFPMSRSSSQCSIWRGTTPDDQFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.75
4 0.8
5 0.85
6 0.86
7 0.88
8 0.91
9 0.92
10 0.92
11 0.93
12 0.92
13 0.93
14 0.93
15 0.91
16 0.91
17 0.89
18 0.83
19 0.76
20 0.74
21 0.65
22 0.6
23 0.51
24 0.42
25 0.34
26 0.28
27 0.24
28 0.14
29 0.11
30 0.05
31 0.03
32 0.02
33 0.02
34 0.02
35 0.03
36 0.04
37 0.04
38 0.04
39 0.06
40 0.1
41 0.12
42 0.13
43 0.17
44 0.21
45 0.25
46 0.27
47 0.32
48 0.31
49 0.33
50 0.37
51 0.37
52 0.36
53 0.34
54 0.36
55 0.33
56 0.35
57 0.41
58 0.39