Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RR38

Protein Details
Accession A0A2J6RR38    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-23GLSYYECSRRRPKTRPYFVAAFHydrophilic
207-226SESPRRRRSHHSGSSRHSRGBasic
NLS Segment(s)
PositionSequence
204-231GLPSESPRRRRSHHSGSSRHSRGSRSSR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGLSYYECSRRRPKTRPYFVAAFPIDPQAKLYNPNLPTQFQYLSVKAYVDTAAGCNAVSSQFANSIGLPIRRYRQPKRIPVPGGFIISIGTTAAPFQYEGKQRWLSKHQVSRPRVGKPWLKLQRSWTPRRFWVDVAEYETPDTDSDSNDPEPDEPWLQFEDVRQPKEMLLEVIEDCPRPLILGAEFIHKFEIFAKRRFRVSPAGLPSESPRRRRSHHSGSSRHSRGSRSSRGSLGRGWLHNIIDRQRYRLGLIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.86
3 0.86
4 0.83
5 0.79
6 0.71
7 0.71
8 0.61
9 0.52
10 0.42
11 0.42
12 0.35
13 0.29
14 0.3
15 0.24
16 0.24
17 0.27
18 0.28
19 0.29
20 0.29
21 0.35
22 0.36
23 0.34
24 0.36
25 0.35
26 0.33
27 0.29
28 0.32
29 0.26
30 0.26
31 0.25
32 0.23
33 0.18
34 0.18
35 0.15
36 0.11
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.1
51 0.09
52 0.11
53 0.13
54 0.15
55 0.16
56 0.17
57 0.21
58 0.27
59 0.36
60 0.41
61 0.49
62 0.56
63 0.66
64 0.7
65 0.75
66 0.73
67 0.67
68 0.65
69 0.57
70 0.49
71 0.39
72 0.31
73 0.22
74 0.17
75 0.15
76 0.08
77 0.06
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.06
84 0.11
85 0.17
86 0.19
87 0.25
88 0.31
89 0.32
90 0.37
91 0.41
92 0.42
93 0.45
94 0.51
95 0.53
96 0.57
97 0.58
98 0.62
99 0.61
100 0.58
101 0.54
102 0.52
103 0.5
104 0.43
105 0.51
106 0.52
107 0.49
108 0.47
109 0.5
110 0.53
111 0.56
112 0.61
113 0.56
114 0.51
115 0.53
116 0.57
117 0.52
118 0.43
119 0.4
120 0.35
121 0.3
122 0.31
123 0.27
124 0.21
125 0.2
126 0.19
127 0.15
128 0.11
129 0.11
130 0.07
131 0.07
132 0.08
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.1
139 0.12
140 0.12
141 0.1
142 0.11
143 0.12
144 0.12
145 0.12
146 0.12
147 0.2
148 0.23
149 0.25
150 0.25
151 0.24
152 0.24
153 0.26
154 0.25
155 0.16
156 0.11
157 0.12
158 0.11
159 0.12
160 0.13
161 0.11
162 0.11
163 0.11
164 0.1
165 0.08
166 0.08
167 0.07
168 0.07
169 0.12
170 0.12
171 0.18
172 0.18
173 0.18
174 0.19
175 0.18
176 0.18
177 0.17
178 0.27
179 0.25
180 0.32
181 0.4
182 0.42
183 0.46
184 0.48
185 0.48
186 0.47
187 0.48
188 0.49
189 0.47
190 0.5
191 0.46
192 0.45
193 0.46
194 0.48
195 0.48
196 0.47
197 0.48
198 0.49
199 0.54
200 0.63
201 0.68
202 0.68
203 0.72
204 0.75
205 0.76
206 0.78
207 0.84
208 0.78
209 0.74
210 0.66
211 0.6
212 0.59
213 0.59
214 0.61
215 0.57
216 0.58
217 0.58
218 0.6
219 0.59
220 0.52
221 0.5
222 0.47
223 0.42
224 0.42
225 0.4
226 0.37
227 0.39
228 0.42
229 0.41
230 0.44
231 0.44
232 0.44
233 0.45
234 0.45