Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S3C6

Protein Details
Accession A0A2J6S3C6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21APSTKSSKGKQAKVTNKFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 8.5, mito 6, cyto 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPSTKSSKGKQAKVTNKFIINASQPASDKIFDVSAFEKFLQDKIKVDNRVGNLGDVVLIKNLGDGKIEVTAHTQFSGRYLKYLTKKFLKKQQLRDWLRVVSTSKGVYELRFFNVVNDADEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.77
4 0.71
5 0.64
6 0.56
7 0.5
8 0.43
9 0.38
10 0.32
11 0.29
12 0.26
13 0.27
14 0.27
15 0.23
16 0.2
17 0.17
18 0.16
19 0.13
20 0.14
21 0.13
22 0.12
23 0.14
24 0.13
25 0.14
26 0.13
27 0.16
28 0.18
29 0.17
30 0.18
31 0.22
32 0.3
33 0.3
34 0.31
35 0.32
36 0.3
37 0.32
38 0.31
39 0.25
40 0.17
41 0.15
42 0.14
43 0.1
44 0.09
45 0.05
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.07
55 0.08
56 0.07
57 0.09
58 0.1
59 0.1
60 0.11
61 0.1
62 0.08
63 0.11
64 0.16
65 0.14
66 0.14
67 0.16
68 0.22
69 0.29
70 0.34
71 0.38
72 0.42
73 0.49
74 0.55
75 0.63
76 0.68
77 0.69
78 0.74
79 0.78
80 0.8
81 0.78
82 0.77
83 0.72
84 0.63
85 0.56
86 0.49
87 0.41
88 0.33
89 0.3
90 0.25
91 0.21
92 0.22
93 0.22
94 0.21
95 0.22
96 0.22
97 0.22
98 0.24
99 0.24
100 0.22
101 0.26
102 0.25
103 0.23
104 0.23
105 0.2