Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6S576

Protein Details
Accession A0A2J6S576    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APAATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences APAATGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLITVATLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLTIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.89
4 0.93
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.33
16 0.25
17 0.18
18 0.17
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.14
25 0.15
26 0.19
27 0.21
28 0.23
29 0.27
30 0.28
31 0.25
32 0.24
33 0.22
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.12
47 0.15
48 0.17
49 0.18
50 0.2
51 0.19
52 0.18
53 0.19
54 0.17
55 0.2
56 0.18
57 0.2
58 0.24
59 0.26
60 0.26
61 0.28
62 0.28
63 0.23
64 0.27
65 0.32
66 0.36
67 0.37
68 0.4
69 0.4
70 0.42
71 0.47
72 0.44
73 0.39
74 0.31
75 0.31
76 0.28