Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RPG7

Protein Details
Accession A0A2J6RPG7    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-59LASARKWKEKLKKWKFNKNRSASDMHydrophilic
86-105ITKERIEHFKRKKTKSEVEIBasic
NLS Segment(s)
PositionSequence
38-53ARKWKEKLKKWKFNKN
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences QKWDSLKDEIHSIYLINDATLKNTKPSIENKHGFLASARKWKEKLKKWKFNKNRSASDMNIILSKAEKRVREEGKETVFFHGKTHITKERIEHFKRKKTKSEVEIVSSIAGMSEAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.1
4 0.12
5 0.1
6 0.14
7 0.18
8 0.18
9 0.18
10 0.2
11 0.21
12 0.24
13 0.32
14 0.37
15 0.43
16 0.45
17 0.45
18 0.47
19 0.46
20 0.41
21 0.35
22 0.33
23 0.29
24 0.34
25 0.34
26 0.34
27 0.37
28 0.44
29 0.53
30 0.56
31 0.62
32 0.64
33 0.73
34 0.78
35 0.86
36 0.88
37 0.89
38 0.89
39 0.86
40 0.8
41 0.75
42 0.71
43 0.6
44 0.53
45 0.43
46 0.33
47 0.26
48 0.2
49 0.14
50 0.11
51 0.11
52 0.13
53 0.15
54 0.17
55 0.21
56 0.29
57 0.34
58 0.37
59 0.4
60 0.4
61 0.41
62 0.43
63 0.39
64 0.35
65 0.34
66 0.3
67 0.27
68 0.27
69 0.25
70 0.23
71 0.29
72 0.32
73 0.32
74 0.34
75 0.38
76 0.42
77 0.5
78 0.54
79 0.58
80 0.61
81 0.68
82 0.76
83 0.78
84 0.79
85 0.78
86 0.82
87 0.78
88 0.78
89 0.73
90 0.69
91 0.63
92 0.54
93 0.45
94 0.35
95 0.27
96 0.17