Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RA77

Protein Details
Accession A0A2J6RA77    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
239-264AEKVQAKKTPVKKTPTKKNTTVNTSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MQSEELQKQLVEAKSTLELLQARRDSELSRMRREILEGEEYFERLIAKDKKEIERIENELKAEVSREKANWKEWPQAELIRQWETGDFDYEHFKDTDNALVLRYAYKACMPDAEPRSVSRIMRVSAQVAAGWYKSPLEAPHCNPPRDKSDEASPKATPLKKTPAKETATKATTPAGLTPTKATPAKTATAKTAKTAPPKTPPAKDPSTKTTPAKTSKPKTTPAQETNVARGTEAVKSLAEKVQAKKTPVKKTPTKKNTTVNTSAEPNQITTPTPVRGIKRAHDTTSLAGEMDGGESQQQPAGKKAKTSMQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.24
4 0.21
5 0.23
6 0.22
7 0.3
8 0.3
9 0.29
10 0.3
11 0.31
12 0.28
13 0.33
14 0.4
15 0.38
16 0.43
17 0.44
18 0.45
19 0.44
20 0.45
21 0.4
22 0.35
23 0.36
24 0.29
25 0.3
26 0.28
27 0.28
28 0.25
29 0.22
30 0.18
31 0.11
32 0.2
33 0.23
34 0.25
35 0.31
36 0.37
37 0.43
38 0.5
39 0.53
40 0.5
41 0.49
42 0.53
43 0.53
44 0.49
45 0.43
46 0.38
47 0.35
48 0.29
49 0.26
50 0.21
51 0.18
52 0.19
53 0.2
54 0.26
55 0.29
56 0.34
57 0.39
58 0.41
59 0.47
60 0.46
61 0.46
62 0.43
63 0.43
64 0.41
65 0.37
66 0.36
67 0.29
68 0.28
69 0.26
70 0.24
71 0.22
72 0.2
73 0.19
74 0.16
75 0.14
76 0.19
77 0.19
78 0.2
79 0.17
80 0.17
81 0.16
82 0.16
83 0.18
84 0.15
85 0.15
86 0.13
87 0.14
88 0.13
89 0.12
90 0.13
91 0.1
92 0.09
93 0.1
94 0.11
95 0.11
96 0.13
97 0.14
98 0.21
99 0.25
100 0.27
101 0.26
102 0.25
103 0.29
104 0.3
105 0.28
106 0.23
107 0.23
108 0.21
109 0.22
110 0.23
111 0.2
112 0.17
113 0.17
114 0.14
115 0.11
116 0.11
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.07
123 0.08
124 0.13
125 0.17
126 0.2
127 0.3
128 0.35
129 0.36
130 0.37
131 0.39
132 0.39
133 0.41
134 0.39
135 0.31
136 0.35
137 0.42
138 0.43
139 0.43
140 0.38
141 0.34
142 0.38
143 0.39
144 0.31
145 0.27
146 0.34
147 0.37
148 0.39
149 0.42
150 0.44
151 0.45
152 0.47
153 0.47
154 0.45
155 0.41
156 0.39
157 0.34
158 0.27
159 0.26
160 0.21
161 0.18
162 0.14
163 0.12
164 0.13
165 0.14
166 0.14
167 0.16
168 0.17
169 0.17
170 0.17
171 0.19
172 0.22
173 0.23
174 0.24
175 0.26
176 0.3
177 0.3
178 0.29
179 0.33
180 0.34
181 0.4
182 0.42
183 0.41
184 0.43
185 0.51
186 0.55
187 0.53
188 0.52
189 0.51
190 0.54
191 0.54
192 0.52
193 0.5
194 0.52
195 0.52
196 0.52
197 0.5
198 0.51
199 0.52
200 0.56
201 0.59
202 0.6
203 0.64
204 0.66
205 0.67
206 0.67
207 0.69
208 0.7
209 0.64
210 0.62
211 0.58
212 0.55
213 0.53
214 0.5
215 0.42
216 0.32
217 0.29
218 0.24
219 0.2
220 0.19
221 0.15
222 0.11
223 0.12
224 0.14
225 0.15
226 0.19
227 0.22
228 0.26
229 0.34
230 0.39
231 0.42
232 0.48
233 0.55
234 0.61
235 0.63
236 0.68
237 0.69
238 0.74
239 0.82
240 0.84
241 0.83
242 0.81
243 0.82
244 0.82
245 0.8
246 0.77
247 0.7
248 0.63
249 0.59
250 0.55
251 0.49
252 0.41
253 0.35
254 0.29
255 0.26
256 0.24
257 0.23
258 0.24
259 0.22
260 0.26
261 0.29
262 0.32
263 0.38
264 0.41
265 0.43
266 0.49
267 0.52
268 0.5
269 0.5
270 0.49
271 0.44
272 0.43
273 0.37
274 0.27
275 0.22
276 0.19
277 0.15
278 0.13
279 0.1
280 0.07
281 0.08
282 0.09
283 0.1
284 0.12
285 0.14
286 0.15
287 0.22
288 0.3
289 0.3
290 0.33
291 0.38