Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RFP0

Protein Details
Accession A0A2J6RFP0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-70AAKGTPRKRAPPAKKTPKKIMKNDSGDHydrophilic
NLS Segment(s)
PositionSequence
44-63AAKGTPRKRAPPAKKTPKKI
Subcellular Location(s) nucl 15, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MARLLNDGTTASALEHVFRPIKKEGAAMKAAIARDNGDGPADGAAKGTPRKRAPPAKKTPKKIMKNDSGDDDDEPGSSFDNTPSKKKGNLNKVQTGRIAKASPRSARAAAPAPGTFAELSDDDDENVKEESMNDGSDEYEVHANGHRNGHANGNGYVDDDMNGYDYDDQFIDAQEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.2
5 0.21
6 0.25
7 0.26
8 0.29
9 0.28
10 0.33
11 0.33
12 0.34
13 0.36
14 0.31
15 0.3
16 0.3
17 0.29
18 0.25
19 0.21
20 0.16
21 0.16
22 0.16
23 0.14
24 0.12
25 0.11
26 0.1
27 0.11
28 0.1
29 0.09
30 0.08
31 0.08
32 0.11
33 0.16
34 0.19
35 0.25
36 0.28
37 0.35
38 0.44
39 0.54
40 0.61
41 0.66
42 0.75
43 0.78
44 0.84
45 0.85
46 0.87
47 0.86
48 0.86
49 0.84
50 0.82
51 0.8
52 0.77
53 0.72
54 0.65
55 0.57
56 0.49
57 0.4
58 0.32
59 0.22
60 0.16
61 0.15
62 0.11
63 0.08
64 0.08
65 0.08
66 0.08
67 0.14
68 0.15
69 0.18
70 0.22
71 0.24
72 0.29
73 0.35
74 0.41
75 0.46
76 0.53
77 0.56
78 0.6
79 0.6
80 0.57
81 0.54
82 0.48
83 0.39
84 0.33
85 0.28
86 0.22
87 0.25
88 0.3
89 0.28
90 0.29
91 0.3
92 0.29
93 0.28
94 0.3
95 0.27
96 0.23
97 0.23
98 0.2
99 0.18
100 0.17
101 0.17
102 0.14
103 0.1
104 0.1
105 0.08
106 0.11
107 0.11
108 0.11
109 0.11
110 0.12
111 0.12
112 0.11
113 0.12
114 0.09
115 0.08
116 0.08
117 0.11
118 0.11
119 0.11
120 0.1
121 0.1
122 0.1
123 0.1
124 0.1
125 0.08
126 0.09
127 0.09
128 0.1
129 0.13
130 0.16
131 0.19
132 0.22
133 0.22
134 0.23
135 0.25
136 0.29
137 0.29
138 0.29
139 0.27
140 0.26
141 0.25
142 0.23
143 0.22
144 0.17
145 0.14
146 0.11
147 0.1
148 0.09
149 0.09
150 0.09
151 0.11
152 0.11
153 0.12
154 0.12
155 0.13
156 0.12
157 0.12