Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S049

Protein Details
Accession A0A2J6S049    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-126DSLSRHHHHRRHSDERERDRGEBasic
NLS Segment(s)
PositionSequence
78-133RSKKESDKQLKRPLHKPIVVSRGSKSADSLSRHHHHRRHSDERERDRGEGSSRRRS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MASVEKNRYWIPNFDINKKVITQEIQYYLGPEATVRPYTRDGEDGFLITTPGECLTDEQIDDICLKSKEVWEKQAAARSKKESDKQLKRPLHKPIVVSRGSKSADSLSRHHHHRRHSDERERDRGEGSSRRRSDERRFDQRDRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.47
4 0.45
5 0.42
6 0.37
7 0.31
8 0.29
9 0.25
10 0.25
11 0.28
12 0.28
13 0.26
14 0.26
15 0.24
16 0.21
17 0.18
18 0.13
19 0.12
20 0.12
21 0.16
22 0.15
23 0.17
24 0.2
25 0.23
26 0.24
27 0.24
28 0.22
29 0.21
30 0.21
31 0.19
32 0.16
33 0.13
34 0.12
35 0.09
36 0.08
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.08
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.12
55 0.19
56 0.2
57 0.24
58 0.23
59 0.26
60 0.27
61 0.33
62 0.35
63 0.31
64 0.33
65 0.33
66 0.36
67 0.39
68 0.42
69 0.45
70 0.51
71 0.57
72 0.63
73 0.69
74 0.72
75 0.72
76 0.74
77 0.74
78 0.71
79 0.64
80 0.59
81 0.56
82 0.56
83 0.54
84 0.49
85 0.41
86 0.39
87 0.37
88 0.34
89 0.28
90 0.25
91 0.27
92 0.29
93 0.31
94 0.33
95 0.37
96 0.44
97 0.52
98 0.53
99 0.56
100 0.62
101 0.69
102 0.71
103 0.75
104 0.79
105 0.81
106 0.84
107 0.85
108 0.78
109 0.7
110 0.62
111 0.55
112 0.51
113 0.5
114 0.48
115 0.49
116 0.48
117 0.53
118 0.58
119 0.62
120 0.66
121 0.68
122 0.71
123 0.71
124 0.78