Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RY82

Protein Details
Accession A0A2J6RY82    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
170-209VTEKAFKQLEKKKRAFRDARAARRRRARDRGYRRWDMREABasic
NLS Segment(s)
PositionSequence
178-202LEKKKRAFRDARAARRRRARDRGYR
Subcellular Location(s) mito_nucl 11, nucl 10, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MPSYMFYRNRRTPFNFGYPEVKQKGLPAFFSRLKEDYNEAKERLAQDAAKRQTWQYQHAKMSASGEKSIALLATGTIKLVFHDMIHDFWIFQLKSFSSSSNTWMPLIQPASDSPASRSTEFTSIHGSVPLWTGAYWPAWKGALPVSGLWLTLEDWFPAHLHFNFELGKYVTEKAFKQLEKKKRAFRDARAARRRRARDRGYRRWDMREALGDATTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.66
3 0.61
4 0.62
5 0.57
6 0.6
7 0.54
8 0.48
9 0.39
10 0.39
11 0.43
12 0.38
13 0.38
14 0.34
15 0.38
16 0.41
17 0.44
18 0.43
19 0.37
20 0.36
21 0.35
22 0.36
23 0.37
24 0.39
25 0.41
26 0.37
27 0.36
28 0.38
29 0.37
30 0.34
31 0.29
32 0.25
33 0.25
34 0.34
35 0.37
36 0.36
37 0.36
38 0.34
39 0.38
40 0.39
41 0.43
42 0.42
43 0.45
44 0.46
45 0.47
46 0.47
47 0.42
48 0.43
49 0.38
50 0.31
51 0.25
52 0.21
53 0.19
54 0.18
55 0.17
56 0.12
57 0.07
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.05
69 0.08
70 0.09
71 0.09
72 0.11
73 0.11
74 0.09
75 0.09
76 0.15
77 0.12
78 0.12
79 0.13
80 0.12
81 0.15
82 0.15
83 0.16
84 0.14
85 0.15
86 0.18
87 0.19
88 0.2
89 0.17
90 0.17
91 0.16
92 0.16
93 0.16
94 0.12
95 0.1
96 0.09
97 0.13
98 0.14
99 0.14
100 0.12
101 0.17
102 0.19
103 0.19
104 0.21
105 0.18
106 0.22
107 0.22
108 0.21
109 0.2
110 0.19
111 0.19
112 0.18
113 0.16
114 0.13
115 0.13
116 0.12
117 0.08
118 0.06
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08
124 0.09
125 0.09
126 0.09
127 0.09
128 0.1
129 0.11
130 0.11
131 0.11
132 0.12
133 0.12
134 0.12
135 0.11
136 0.1
137 0.08
138 0.09
139 0.09
140 0.07
141 0.07
142 0.08
143 0.08
144 0.08
145 0.12
146 0.11
147 0.15
148 0.15
149 0.17
150 0.17
151 0.17
152 0.2
153 0.17
154 0.18
155 0.16
156 0.17
157 0.17
158 0.2
159 0.2
160 0.22
161 0.29
162 0.29
163 0.37
164 0.45
165 0.53
166 0.6
167 0.68
168 0.72
169 0.74
170 0.83
171 0.81
172 0.8
173 0.81
174 0.81
175 0.84
176 0.85
177 0.83
178 0.81
179 0.84
180 0.85
181 0.84
182 0.84
183 0.83
184 0.84
185 0.87
186 0.9
187 0.89
188 0.9
189 0.85
190 0.82
191 0.77
192 0.7
193 0.65
194 0.6
195 0.53
196 0.45
197 0.39