Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RZV7

Protein Details
Accession A0A2J6RZV7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-24LPTFRSLAARRQQKKEEQPDGVHydrophilic
285-309ACCCASRRDVRTGRRKGRKSAYGDVHydrophilic
NLS Segment(s)
PositionSequence
295-333RTGRRKGRKSAYGDVGSDEKKRPVAGGRRWAKMPRFGRR
Subcellular Location(s) plas 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017974  Claudin_CS  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
PROSITE View protein in PROSITE  
PS01346  CLAUDIN  
Amino Acid Sequences MVLPTFRSLAARRQQKKEEQPDGVINTENTSERTLTPNGTYIPGVDIKLATKTRRNWILLSSLFFFISGIFLILVEIGNINNKPVIRKTFFFTLNLTNIIPASAGDIQLVNSLARSLGLHDFYQVGLWNFCEGYNGEGITDCSPTKTLYWFNPVEILLNELLAGATIALPAEINNILNLIKIASHLMFGFFLTGTCINFVNIFLAPIVLYSRWWSFPFAIWTFISALLTTAATIIATVMFVIFRNVITSQQGLNIGAGLGIQMFVFMWIAAAFSIFAWLIHAGLACCCASRRDVRTGRRKGRKSAYGDVGSDEKKRPVAGGRRWAKMPRFGRRVSAGQGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.82
4 0.83
5 0.83
6 0.77
7 0.73
8 0.71
9 0.66
10 0.57
11 0.49
12 0.38
13 0.31
14 0.28
15 0.24
16 0.2
17 0.19
18 0.18
19 0.17
20 0.22
21 0.22
22 0.22
23 0.23
24 0.24
25 0.24
26 0.24
27 0.23
28 0.19
29 0.2
30 0.19
31 0.18
32 0.16
33 0.15
34 0.14
35 0.2
36 0.24
37 0.25
38 0.31
39 0.36
40 0.44
41 0.51
42 0.53
43 0.48
44 0.47
45 0.5
46 0.45
47 0.43
48 0.37
49 0.3
50 0.27
51 0.25
52 0.22
53 0.14
54 0.12
55 0.09
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.07
66 0.07
67 0.08
68 0.1
69 0.11
70 0.14
71 0.18
72 0.26
73 0.27
74 0.29
75 0.33
76 0.38
77 0.39
78 0.38
79 0.36
80 0.33
81 0.31
82 0.31
83 0.26
84 0.19
85 0.17
86 0.16
87 0.13
88 0.08
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.1
97 0.07
98 0.06
99 0.06
100 0.05
101 0.06
102 0.05
103 0.07
104 0.09
105 0.11
106 0.11
107 0.11
108 0.12
109 0.11
110 0.12
111 0.11
112 0.09
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.07
120 0.08
121 0.08
122 0.08
123 0.07
124 0.07
125 0.09
126 0.08
127 0.09
128 0.08
129 0.08
130 0.09
131 0.09
132 0.1
133 0.11
134 0.14
135 0.14
136 0.21
137 0.21
138 0.2
139 0.22
140 0.21
141 0.19
142 0.16
143 0.15
144 0.09
145 0.08
146 0.08
147 0.06
148 0.06
149 0.04
150 0.04
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.06
191 0.06
192 0.05
193 0.05
194 0.06
195 0.05
196 0.05
197 0.07
198 0.08
199 0.1
200 0.11
201 0.13
202 0.13
203 0.16
204 0.21
205 0.2
206 0.21
207 0.19
208 0.2
209 0.19
210 0.18
211 0.16
212 0.1
213 0.1
214 0.07
215 0.07
216 0.06
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.05
230 0.05
231 0.07
232 0.08
233 0.09
234 0.1
235 0.12
236 0.11
237 0.13
238 0.14
239 0.13
240 0.12
241 0.11
242 0.09
243 0.07
244 0.07
245 0.05
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.04
253 0.03
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.05
262 0.05
263 0.05
264 0.06
265 0.06
266 0.06
267 0.07
268 0.08
269 0.07
270 0.07
271 0.09
272 0.08
273 0.08
274 0.09
275 0.1
276 0.14
277 0.22
278 0.26
279 0.35
280 0.44
281 0.54
282 0.64
283 0.73
284 0.8
285 0.83
286 0.84
287 0.84
288 0.85
289 0.84
290 0.81
291 0.79
292 0.77
293 0.71
294 0.65
295 0.58
296 0.54
297 0.48
298 0.45
299 0.39
300 0.33
301 0.3
302 0.3
303 0.3
304 0.34
305 0.41
306 0.46
307 0.53
308 0.57
309 0.6
310 0.65
311 0.7
312 0.67
313 0.67
314 0.67
315 0.67
316 0.68
317 0.65
318 0.67
319 0.66
320 0.65