Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RXS2

Protein Details
Accession A0A2J6RXS2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MRAKWRKKRVRRLKRKRRKTRARSKQLTTTRSBasic
NLS Segment(s)
PositionSequence
3-25AKWRKKRVRRLKRKRRKTRARSK
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRAKWRKKRVRRLKRKRRKTRARSKQLTTTRSRSLLPIELYRHLPHQRLRLFQHTKSHAQFGTTIQYNGSWMFKDRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.97
8 0.96
9 0.96
10 0.93
11 0.88
12 0.87
13 0.84
14 0.79
15 0.75
16 0.69
17 0.62
18 0.55
19 0.49
20 0.4
21 0.34
22 0.31
23 0.27
24 0.25
25 0.23
26 0.23
27 0.24
28 0.23
29 0.26
30 0.24
31 0.26
32 0.27
33 0.33
34 0.35
35 0.38
36 0.42
37 0.47
38 0.5
39 0.51
40 0.56
41 0.53
42 0.56
43 0.53
44 0.53
45 0.43
46 0.39
47 0.36
48 0.3
49 0.32
50 0.27
51 0.25
52 0.2
53 0.2
54 0.2
55 0.2
56 0.2
57 0.14
58 0.15