Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RF16

Protein Details
Accession A0A2J6RF16    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-73APPSGKKARKLEKARNHARQRABasic
NLS Segment(s)
PositionSequence
14-25RRIASRAKVQKR
54-71PSGKKARKLEKARNHARQ
Subcellular Location(s) nucl 15.5, mito_nucl 12.333, mito 8, cyto_mito 6.333
Family & Domain DBs
Amino Acid Sequences MPSRGNPNVPNKQRRIASRAKVQKRNAVNKISKNPRGTAQSNVLLPTSGPLAPPSGKKARKLEKARNHARQRAVEKAMAQEGEVYMTDAPKTTKSKTTKKAEDEMDVDGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.67
4 0.66
5 0.66
6 0.72
7 0.74
8 0.77
9 0.76
10 0.76
11 0.76
12 0.78
13 0.75
14 0.73
15 0.71
16 0.7
17 0.75
18 0.76
19 0.73
20 0.66
21 0.61
22 0.57
23 0.56
24 0.5
25 0.45
26 0.4
27 0.36
28 0.34
29 0.32
30 0.27
31 0.2
32 0.18
33 0.14
34 0.1
35 0.07
36 0.07
37 0.06
38 0.08
39 0.09
40 0.11
41 0.15
42 0.22
43 0.25
44 0.3
45 0.38
46 0.45
47 0.54
48 0.61
49 0.67
50 0.68
51 0.76
52 0.8
53 0.83
54 0.81
55 0.78
56 0.75
57 0.71
58 0.66
59 0.63
60 0.56
61 0.48
62 0.41
63 0.37
64 0.34
65 0.27
66 0.22
67 0.16
68 0.13
69 0.12
70 0.11
71 0.09
72 0.07
73 0.08
74 0.08
75 0.08
76 0.1
77 0.14
78 0.18
79 0.21
80 0.29
81 0.37
82 0.48
83 0.56
84 0.66
85 0.69
86 0.72
87 0.77
88 0.72
89 0.7
90 0.62
91 0.55