Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6QZU2

Protein Details
Accession A0A2J6QZU2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
126-145EGEKKGKGKGKGKGKKDDGCBasic
NLS Segment(s)
PositionSequence
94-141LSKEVRVRNERVRARREERERERREGEGGKRVEGEKKGKGKGKGKGKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLNQDEDDPSPSWQNMPIETVEPRPKRTGKKGFLPGIWSAKDGPGPAAWRCDNTAIRGQVRRKGERDPMNGGLRMTRAMAETRRWREVGPLPPLSKEVRVRNERVRARREERERERREGEGGKRVEGEKKGKGKGKGKGKKDDGCAVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.22
4 0.22
5 0.21
6 0.22
7 0.29
8 0.34
9 0.35
10 0.38
11 0.43
12 0.48
13 0.54
14 0.62
15 0.66
16 0.63
17 0.7
18 0.75
19 0.73
20 0.67
21 0.63
22 0.57
23 0.51
24 0.45
25 0.36
26 0.28
27 0.24
28 0.23
29 0.2
30 0.16
31 0.13
32 0.15
33 0.15
34 0.19
35 0.19
36 0.19
37 0.2
38 0.24
39 0.22
40 0.23
41 0.28
42 0.26
43 0.29
44 0.34
45 0.36
46 0.37
47 0.42
48 0.44
49 0.4
50 0.42
51 0.47
52 0.48
53 0.5
54 0.49
55 0.48
56 0.45
57 0.44
58 0.39
59 0.31
60 0.23
61 0.19
62 0.14
63 0.09
64 0.08
65 0.09
66 0.11
67 0.16
68 0.24
69 0.27
70 0.29
71 0.3
72 0.29
73 0.32
74 0.37
75 0.38
76 0.36
77 0.37
78 0.36
79 0.36
80 0.38
81 0.34
82 0.33
83 0.32
84 0.33
85 0.37
86 0.42
87 0.46
88 0.52
89 0.6
90 0.63
91 0.65
92 0.65
93 0.64
94 0.66
95 0.71
96 0.72
97 0.73
98 0.76
99 0.79
100 0.78
101 0.77
102 0.73
103 0.65
104 0.62
105 0.59
106 0.53
107 0.51
108 0.47
109 0.41
110 0.4
111 0.4
112 0.4
113 0.39
114 0.4
115 0.4
116 0.46
117 0.52
118 0.57
119 0.64
120 0.66
121 0.69
122 0.74
123 0.75
124 0.76
125 0.79
126 0.81
127 0.79
128 0.78