Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RIS9

Protein Details
Accession A0A2J6RIS9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
214-244GLPRGRPRKPDSEKKVKPPSGRGRGRPPKAABasic
260-281AGAGEAKKRGRKPKVKDDADVNBasic
NLS Segment(s)
PositionSequence
205-275EPKPEKVPSGLPRGRPRKPDSEKKVKPPSGRGRGRPPKAAAGEQKAAAGEEKAAEAGAGEAKKRGRKPKVK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.333, mito_nucl 9.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAGTIDAKAFKDALQRYPALLKSIAKPPKEGQLSLEELDTFRYTGAPIAYSSKTGRTMDSKDLQKLVEWKLRHGIFRPGLSKKVASNSDKTIAAASKEAFTYYAEKPSDITGVLDKLSKPLMGIGPATASLLLAVHDPSNVVFFSDELYRWLLHDGKKVSPKYTAKEFEELFSKAKSFMSRIKCTPIELEKAAFVIIKENDPVKEPKPEKVPSGLPRGRPRKPDSEKKVKPPSGRGRGRPPKAAAGEQKAAAGEEKAAEAGAGEAKKRGRKPKVKDDADVNAEEPEETTATPARKKRKFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.4
5 0.39
6 0.35
7 0.34
8 0.32
9 0.31
10 0.4
11 0.44
12 0.4
13 0.43
14 0.42
15 0.48
16 0.49
17 0.45
18 0.38
19 0.38
20 0.41
21 0.37
22 0.35
23 0.26
24 0.21
25 0.24
26 0.21
27 0.15
28 0.11
29 0.1
30 0.1
31 0.12
32 0.12
33 0.1
34 0.11
35 0.15
36 0.16
37 0.18
38 0.2
39 0.21
40 0.24
41 0.24
42 0.26
43 0.27
44 0.31
45 0.36
46 0.42
47 0.44
48 0.43
49 0.44
50 0.41
51 0.38
52 0.39
53 0.38
54 0.37
55 0.33
56 0.32
57 0.38
58 0.4
59 0.4
60 0.37
61 0.39
62 0.37
63 0.41
64 0.45
65 0.4
66 0.41
67 0.4
68 0.4
69 0.33
70 0.36
71 0.38
72 0.35
73 0.36
74 0.37
75 0.38
76 0.36
77 0.34
78 0.29
79 0.23
80 0.21
81 0.19
82 0.15
83 0.13
84 0.13
85 0.13
86 0.11
87 0.11
88 0.15
89 0.14
90 0.2
91 0.19
92 0.19
93 0.19
94 0.2
95 0.19
96 0.15
97 0.14
98 0.09
99 0.1
100 0.1
101 0.11
102 0.1
103 0.1
104 0.11
105 0.1
106 0.08
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.06
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.1
139 0.12
140 0.13
141 0.18
142 0.19
143 0.22
144 0.29
145 0.3
146 0.3
147 0.34
148 0.36
149 0.35
150 0.4
151 0.41
152 0.36
153 0.4
154 0.38
155 0.32
156 0.32
157 0.3
158 0.23
159 0.19
160 0.17
161 0.13
162 0.14
163 0.14
164 0.14
165 0.2
166 0.26
167 0.3
168 0.32
169 0.37
170 0.36
171 0.36
172 0.38
173 0.34
174 0.31
175 0.27
176 0.26
177 0.2
178 0.2
179 0.19
180 0.15
181 0.11
182 0.11
183 0.11
184 0.11
185 0.13
186 0.14
187 0.14
188 0.17
189 0.2
190 0.18
191 0.27
192 0.28
193 0.32
194 0.38
195 0.4
196 0.39
197 0.41
198 0.46
199 0.42
200 0.51
201 0.5
202 0.49
203 0.57
204 0.63
205 0.64
206 0.65
207 0.66
208 0.66
209 0.71
210 0.75
211 0.75
212 0.77
213 0.79
214 0.81
215 0.86
216 0.82
217 0.78
218 0.78
219 0.79
220 0.78
221 0.79
222 0.76
223 0.76
224 0.8
225 0.8
226 0.77
227 0.7
228 0.67
229 0.63
230 0.63
231 0.59
232 0.56
233 0.53
234 0.46
235 0.43
236 0.35
237 0.31
238 0.25
239 0.18
240 0.11
241 0.09
242 0.09
243 0.08
244 0.08
245 0.07
246 0.06
247 0.06
248 0.1
249 0.1
250 0.11
251 0.15
252 0.2
253 0.28
254 0.35
255 0.45
256 0.52
257 0.61
258 0.7
259 0.78
260 0.84
261 0.82
262 0.8
263 0.77
264 0.74
265 0.69
266 0.61
267 0.51
268 0.41
269 0.35
270 0.29
271 0.23
272 0.16
273 0.12
274 0.1
275 0.12
276 0.16
277 0.2
278 0.27
279 0.34
280 0.43
281 0.5