Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S854

Protein Details
Accession A0A2J6S854    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-69CDMCMLKKRKCNRKRPICSRCLEDHydrophilic
74-102IYSSSKKKPGPAKGSQRKKPKVSHAQTPNHydrophilic
NLS Segment(s)
PositionSequence
79-94KKKPGPAKGSQRKKPK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTTHNYSAGMASDAFDGLAWQEPPSQNQMPIRATEMVSGSGAPRVCDMCMLKKRKCNRKRPICSRCLEDNLICIYSSSKKKPGPAKGSQRKKPKVSHAQTPNVPTGKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.09
6 0.08
7 0.08
8 0.13
9 0.14
10 0.17
11 0.23
12 0.24
13 0.25
14 0.28
15 0.32
16 0.29
17 0.29
18 0.3
19 0.25
20 0.24
21 0.21
22 0.19
23 0.15
24 0.14
25 0.13
26 0.1
27 0.11
28 0.11
29 0.09
30 0.09
31 0.09
32 0.09
33 0.11
34 0.12
35 0.18
36 0.26
37 0.32
38 0.35
39 0.41
40 0.51
41 0.59
42 0.67
43 0.7
44 0.73
45 0.78
46 0.85
47 0.89
48 0.9
49 0.87
50 0.81
51 0.76
52 0.7
53 0.64
54 0.56
55 0.45
56 0.38
57 0.32
58 0.29
59 0.22
60 0.17
61 0.15
62 0.18
63 0.24
64 0.26
65 0.31
66 0.34
67 0.41
68 0.5
69 0.58
70 0.59
71 0.64
72 0.71
73 0.74
74 0.82
75 0.84
76 0.86
77 0.86
78 0.85
79 0.84
80 0.83
81 0.84
82 0.8
83 0.81
84 0.8
85 0.8
86 0.77
87 0.74
88 0.71