Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RJY0

Protein Details
Accession A0A2J6RJY0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-91PSKVTKASPTPKKRGRKPKVKAEEEEBasic
NLS Segment(s)
PositionSequence
50-86KAKTPKKGKGSGTNTTPSKVTKASPTPKKRGRKPKVK
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 9, mito_nucl 6.999, cyto_pero 6.999
Family & Domain DBs
Amino Acid Sequences MKNKPEVDWDVVAAKSGFNSGKTAATRFGQIKKKWSSMSSEIDTSSSTPKAKTPKKGKGSGTNTTPSKVTKASPTPKKRGRKPKVKAEEEEVEEEAAEAAEVEMKDASAEDEDVVVEEAEFYEAEEVEVYEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.15
4 0.14
5 0.12
6 0.14
7 0.14
8 0.19
9 0.2
10 0.22
11 0.22
12 0.21
13 0.25
14 0.28
15 0.35
16 0.39
17 0.4
18 0.47
19 0.5
20 0.54
21 0.52
22 0.49
23 0.48
24 0.45
25 0.48
26 0.42
27 0.38
28 0.33
29 0.31
30 0.29
31 0.23
32 0.2
33 0.16
34 0.14
35 0.13
36 0.17
37 0.26
38 0.32
39 0.41
40 0.48
41 0.56
42 0.62
43 0.69
44 0.7
45 0.7
46 0.7
47 0.66
48 0.6
49 0.56
50 0.49
51 0.43
52 0.39
53 0.29
54 0.25
55 0.21
56 0.18
57 0.17
58 0.24
59 0.33
60 0.42
61 0.49
62 0.57
63 0.64
64 0.73
65 0.77
66 0.8
67 0.82
68 0.82
69 0.84
70 0.85
71 0.87
72 0.84
73 0.77
74 0.72
75 0.68
76 0.59
77 0.53
78 0.43
79 0.32
80 0.25
81 0.22
82 0.16
83 0.09
84 0.06
85 0.04
86 0.03
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.08
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07