Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6QYW8

Protein Details
Accession A0A2J6QYW8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-91NSCTQRCRNIRARYRTARPSPRCDRARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MVRSHSVQGHCFVNSFKGIRRMASHRHFPQASTIILHTAPRQVNQDGANRYQHHRSFNRLGQHSNSCTQRCRNIRARYRTARPSPRCDRARVTVASDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.29
5 0.29
6 0.31
7 0.35
8 0.38
9 0.43
10 0.48
11 0.53
12 0.49
13 0.56
14 0.54
15 0.49
16 0.5
17 0.43
18 0.37
19 0.29
20 0.25
21 0.18
22 0.18
23 0.18
24 0.13
25 0.16
26 0.16
27 0.16
28 0.18
29 0.17
30 0.2
31 0.22
32 0.26
33 0.23
34 0.25
35 0.28
36 0.27
37 0.29
38 0.33
39 0.33
40 0.35
41 0.34
42 0.39
43 0.41
44 0.43
45 0.49
46 0.45
47 0.44
48 0.42
49 0.45
50 0.41
51 0.4
52 0.42
53 0.36
54 0.38
55 0.4
56 0.45
57 0.45
58 0.5
59 0.55
60 0.59
61 0.67
62 0.72
63 0.77
64 0.77
65 0.8
66 0.82
67 0.82
68 0.83
69 0.8
70 0.8
71 0.8
72 0.81
73 0.77
74 0.73
75 0.7
76 0.67
77 0.67
78 0.6