Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6RN66

Protein Details
Accession A0A2J6RN66    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-47TPPASPPSSKAERNRRKKENTKKRKAEESQKKSEEHydrophilic
NLS Segment(s)
PositionSequence
21-40SKAERNRRKKENTKKRKAEE
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
PROSITE View protein in PROSITE  
PS50280  SET  
Amino Acid Sequences MTLNASTPHLQETPPASPPSSKAERNRRKKENTKKRKAEESQKKSEEADLLSKMSTMSLNKRGVDHDVKDGAPGRLWEIKPSRGKGLGVFAKKDIKKGAAIFQEMPLIQGGSHWLQKEAAFTVLSIERQQDFMELHNQCNCHQSPCIETPFMKIFDASSYQPEGYDHENADARVYKVTSRINHACLANTSRIFTTAGNIVIFWIERYQEGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.3
5 0.32
6 0.36
7 0.38
8 0.41
9 0.46
10 0.56
11 0.65
12 0.74
13 0.82
14 0.84
15 0.87
16 0.91
17 0.92
18 0.92
19 0.93
20 0.93
21 0.93
22 0.91
23 0.91
24 0.89
25 0.89
26 0.89
27 0.86
28 0.85
29 0.78
30 0.72
31 0.63
32 0.56
33 0.47
34 0.38
35 0.34
36 0.25
37 0.22
38 0.2
39 0.19
40 0.17
41 0.14
42 0.14
43 0.12
44 0.16
45 0.23
46 0.27
47 0.27
48 0.28
49 0.29
50 0.33
51 0.36
52 0.32
53 0.29
54 0.28
55 0.27
56 0.28
57 0.29
58 0.23
59 0.19
60 0.17
61 0.16
62 0.2
63 0.2
64 0.24
65 0.25
66 0.32
67 0.37
68 0.38
69 0.38
70 0.33
71 0.34
72 0.28
73 0.33
74 0.31
75 0.28
76 0.27
77 0.26
78 0.32
79 0.32
80 0.33
81 0.27
82 0.22
83 0.23
84 0.23
85 0.27
86 0.22
87 0.24
88 0.22
89 0.21
90 0.21
91 0.18
92 0.17
93 0.11
94 0.09
95 0.06
96 0.06
97 0.07
98 0.07
99 0.09
100 0.09
101 0.1
102 0.1
103 0.11
104 0.12
105 0.11
106 0.1
107 0.08
108 0.08
109 0.1
110 0.1
111 0.1
112 0.1
113 0.11
114 0.1
115 0.1
116 0.11
117 0.1
118 0.09
119 0.1
120 0.18
121 0.18
122 0.19
123 0.21
124 0.22
125 0.21
126 0.27
127 0.26
128 0.2
129 0.21
130 0.2
131 0.23
132 0.26
133 0.29
134 0.25
135 0.25
136 0.26
137 0.29
138 0.29
139 0.24
140 0.19
141 0.17
142 0.17
143 0.2
144 0.17
145 0.16
146 0.17
147 0.16
148 0.17
149 0.17
150 0.17
151 0.18
152 0.19
153 0.17
154 0.18
155 0.19
156 0.19
157 0.22
158 0.21
159 0.19
160 0.18
161 0.19
162 0.17
163 0.21
164 0.27
165 0.28
166 0.34
167 0.38
168 0.38
169 0.42
170 0.42
171 0.39
172 0.36
173 0.38
174 0.36
175 0.32
176 0.31
177 0.26
178 0.27
179 0.26
180 0.22
181 0.21
182 0.18
183 0.19
184 0.17
185 0.16
186 0.15
187 0.15
188 0.15
189 0.13
190 0.11
191 0.1