Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6RB35

Protein Details
Accession A0A2J6RB35    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
149-174VEAAWARSLRRRRNRARRDAVREAGLHydrophilic
NLS Segment(s)
PositionSequence
154-166ARSLRRRRNRARR
Subcellular Location(s) nucl 10, cyto_nucl 9.833, cyto 7.5, cyto_pero 5.666, mito 5, pero 2.5
Family & Domain DBs
Amino Acid Sequences MGWNVSQDTLAHIHDPGPRGDKARADYDVPPMPPHRDRSNIDPNDVQDGALNFWMQQNTSFLCALENPVFWRRKDFAPGEIARMPNTRQFGERLTPRSIYRIERGARELGRRWMNLDFDTGGRIRDPTQNVFDVNRRRLLPGARAAPAVEAAWARSLRRRRNRARRDAVREAGLGLGNLPGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.23
4 0.24
5 0.25
6 0.28
7 0.31
8 0.33
9 0.34
10 0.37
11 0.36
12 0.35
13 0.35
14 0.37
15 0.39
16 0.35
17 0.34
18 0.32
19 0.36
20 0.37
21 0.41
22 0.39
23 0.42
24 0.44
25 0.49
26 0.57
27 0.53
28 0.52
29 0.49
30 0.45
31 0.43
32 0.39
33 0.3
34 0.21
35 0.2
36 0.17
37 0.15
38 0.14
39 0.09
40 0.11
41 0.11
42 0.09
43 0.1
44 0.1
45 0.1
46 0.13
47 0.13
48 0.11
49 0.11
50 0.11
51 0.13
52 0.12
53 0.12
54 0.12
55 0.19
56 0.22
57 0.22
58 0.26
59 0.26
60 0.27
61 0.32
62 0.31
63 0.27
64 0.32
65 0.33
66 0.32
67 0.32
68 0.3
69 0.25
70 0.25
71 0.23
72 0.19
73 0.21
74 0.17
75 0.16
76 0.17
77 0.18
78 0.21
79 0.24
80 0.25
81 0.25
82 0.26
83 0.25
84 0.27
85 0.28
86 0.26
87 0.24
88 0.27
89 0.26
90 0.26
91 0.28
92 0.3
93 0.29
94 0.3
95 0.3
96 0.3
97 0.32
98 0.3
99 0.3
100 0.28
101 0.28
102 0.25
103 0.24
104 0.18
105 0.14
106 0.16
107 0.14
108 0.12
109 0.11
110 0.11
111 0.11
112 0.16
113 0.2
114 0.21
115 0.24
116 0.25
117 0.26
118 0.28
119 0.33
120 0.36
121 0.36
122 0.37
123 0.34
124 0.35
125 0.37
126 0.38
127 0.37
128 0.37
129 0.37
130 0.34
131 0.33
132 0.32
133 0.28
134 0.26
135 0.2
136 0.13
137 0.09
138 0.09
139 0.12
140 0.13
141 0.14
142 0.21
143 0.3
144 0.4
145 0.5
146 0.6
147 0.68
148 0.78
149 0.88
150 0.91
151 0.93
152 0.93
153 0.92
154 0.9
155 0.84
156 0.77
157 0.66
158 0.56
159 0.47
160 0.36
161 0.27
162 0.18