Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FRX9

Protein Details
Accession I2FRX9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
120-147KEAIEEEKKREERKRQIREEKQEKAENKBasic
NLS Segment(s)
PositionSequence
126-143EKKREERKRQIREEKQEK
Subcellular Location(s) mito 13.5, nucl 10, cyto_mito 8, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010530  B12D  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06522  B12D  
Amino Acid Sequences MRPTQITPALRLTSRPAVSHIGLTPRLQRFSTTPLRRDDRSRAKAGPVKNVLNRPEIVPLFLFTGGMICLAVFFAGRHLIKDKELRLDSKQQDRLKTKTEQLDFEAMKRVTEEPEGKPTKEAIEEEKKREERKRQIREEKQEKAENKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.32
4 0.33
5 0.33
6 0.34
7 0.3
8 0.27
9 0.27
10 0.28
11 0.33
12 0.32
13 0.34
14 0.31
15 0.31
16 0.29
17 0.34
18 0.43
19 0.42
20 0.43
21 0.48
22 0.53
23 0.54
24 0.57
25 0.6
26 0.6
27 0.59
28 0.6
29 0.54
30 0.56
31 0.58
32 0.55
33 0.54
34 0.49
35 0.48
36 0.48
37 0.51
38 0.46
39 0.44
40 0.41
41 0.33
42 0.33
43 0.27
44 0.23
45 0.18
46 0.16
47 0.14
48 0.13
49 0.12
50 0.07
51 0.07
52 0.06
53 0.05
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.03
62 0.07
63 0.07
64 0.08
65 0.1
66 0.11
67 0.14
68 0.18
69 0.19
70 0.22
71 0.24
72 0.26
73 0.28
74 0.36
75 0.38
76 0.43
77 0.5
78 0.47
79 0.53
80 0.56
81 0.56
82 0.52
83 0.51
84 0.48
85 0.48
86 0.47
87 0.41
88 0.39
89 0.42
90 0.38
91 0.35
92 0.37
93 0.28
94 0.26
95 0.25
96 0.23
97 0.18
98 0.23
99 0.26
100 0.21
101 0.31
102 0.34
103 0.34
104 0.34
105 0.33
106 0.3
107 0.29
108 0.28
109 0.27
110 0.34
111 0.4
112 0.43
113 0.52
114 0.55
115 0.6
116 0.67
117 0.69
118 0.69
119 0.75
120 0.8
121 0.82
122 0.88
123 0.91
124 0.93
125 0.92
126 0.9
127 0.88
128 0.86