Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2FRN3

Protein Details
Accession I2FRN3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-108ATRLSLNPSNRNRNRNRNRNRNANAPQESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 5, cyto 4, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MPTSSAIGMVAPGNIRVSRRWGGGGDDVGGGDDEVQRCQVKARRNMPPDQSANLLIQTRNSRQRETSEARQADRKQAQPATRLSLNPSNRNRNRNRNRNRNANAPQESKQQRARACTLNLLPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.21
5 0.22
6 0.24
7 0.25
8 0.23
9 0.25
10 0.27
11 0.26
12 0.21
13 0.18
14 0.16
15 0.14
16 0.13
17 0.09
18 0.07
19 0.08
20 0.07
21 0.08
22 0.1
23 0.1
24 0.1
25 0.16
26 0.2
27 0.26
28 0.35
29 0.42
30 0.5
31 0.54
32 0.6
33 0.59
34 0.62
35 0.56
36 0.48
37 0.42
38 0.34
39 0.3
40 0.26
41 0.22
42 0.15
43 0.15
44 0.17
45 0.19
46 0.27
47 0.28
48 0.28
49 0.28
50 0.31
51 0.36
52 0.39
53 0.42
54 0.42
55 0.42
56 0.42
57 0.48
58 0.46
59 0.47
60 0.46
61 0.42
62 0.39
63 0.42
64 0.43
65 0.41
66 0.42
67 0.38
68 0.36
69 0.33
70 0.33
71 0.35
72 0.38
73 0.43
74 0.48
75 0.54
76 0.58
77 0.67
78 0.71
79 0.75
80 0.8
81 0.82
82 0.86
83 0.86
84 0.88
85 0.9
86 0.86
87 0.85
88 0.82
89 0.81
90 0.77
91 0.71
92 0.66
93 0.65
94 0.64
95 0.61
96 0.61
97 0.58
98 0.55
99 0.56
100 0.59
101 0.56
102 0.54
103 0.55