FuNGI

A0A2J6R2V6

Protein Details

Accession

A0A2J6R2V6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
388-408	FEINIDWKRKRERARQLELVV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 20, E.R. 3, mito 2, vacu 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036691 Endo/exonu/phosph_ase_sf IPR046985 IP5 IPR000300 IPPc
Gene Ontology	GO:0016020 C:membrane GO:0016791 F:phosphatase activity GO:0046856 P:phosphatidylinositol dephosphorylation

Amino Acid Sequences

MAGRPNMAALSLYIATFNCGLEAIDTEAFASQLFTGLNSFNLPDVLVLSLQEIAPLPLALIGGSFLVPYFEKFYDAVQKASRKYASAEENGPVYSPIAARNLGMTGIMIFAKDPSCIKDIETGGVGVGLWEMGNKGAVGVRFTFQQGPASTELTFVAAHLAAMEGELQRRNEDWKNIVRGLVFSSTTSKRKTEDTSLSGEERSLLSISPHDASIYKPTSHLFIAGDLNYRTSILSPSPTDHIDIFPQPHHEPDSSNHFSSLFESDQLNQERLAGRTLHGLTEAEITFPPTYKYKSEEPFLTPDDELKKWPWAKHRWPSWCDRILYLPMPAWVTRSQPSLSVVTHKYTALPLFPTSDHRAVTLELSVPIVPIPPPVEEHGDDPRIKPPFEINIDWKRKRERARQLELVVGFALYFTTTKEGGAVAAAVLVGAVGAYFAIRAMVEM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.13
3	0.13
4	0.13
5	0.09
6	0.09
7	0.09
8	0.09
9	0.1
10	0.12
11	0.11
12	0.11
13	0.11
14	0.11
15	0.11
16	0.1
17	0.09
18	0.06
19	0.07
20	0.07
21	0.07
22	0.09
23	0.09
24	0.1
25	0.1
26	0.11
27	0.1
28	0.1
29	0.1
30	0.08
31	0.09
32	0.09
33	0.08
34	0.08
35	0.08
36	0.09
37	0.08
38	0.09
39	0.09
40	0.08
41	0.08
42	0.08
43	0.07
44	0.07
45	0.07
46	0.06
47	0.05
48	0.05
49	0.05
50	0.05
51	0.05
52	0.04
53	0.06
54	0.06
55	0.08
56	0.12
57	0.12
58	0.14
59	0.15
60	0.17
61	0.26
62	0.27
63	0.3
64	0.31
65	0.37
66	0.37
67	0.43
68	0.42
69	0.33
70	0.35
71	0.38
72	0.38
73	0.37
74	0.37
75	0.32
76	0.32
77	0.3
78	0.28
79	0.21
80	0.16
81	0.13
82	0.11
83	0.11
84	0.12
85	0.12
86	0.12
87	0.12
88	0.12
89	0.11
90	0.1
91	0.08
92	0.06
93	0.07
94	0.06
95	0.05
96	0.05
97	0.06
98	0.07
99	0.08
100	0.09
101	0.11
102	0.12
103	0.13
104	0.14
105	0.19
106	0.19
107	0.19
108	0.19
109	0.16
110	0.14
111	0.14
112	0.13
113	0.06
114	0.05
115	0.04
116	0.03
117	0.03
118	0.03
119	0.03
120	0.04
121	0.04
122	0.04
123	0.06
124	0.07
125	0.08
126	0.09
127	0.1
128	0.11
129	0.13
130	0.14
131	0.13
132	0.17
133	0.16
134	0.18
135	0.19
136	0.2
137	0.18
138	0.17
139	0.16
140	0.13
141	0.12
142	0.09
143	0.08
144	0.06
145	0.06
146	0.05
147	0.05
148	0.04
149	0.04
150	0.05
151	0.05
152	0.07
153	0.09
154	0.1
155	0.1
156	0.11
157	0.16
158	0.19
159	0.21
160	0.25
161	0.28
162	0.33
163	0.33
164	0.33
165	0.29
166	0.26
167	0.25
168	0.21
169	0.16
170	0.11
171	0.15
172	0.19
173	0.22
174	0.24
175	0.23
176	0.23
177	0.26
178	0.29
179	0.31
180	0.33
181	0.32
182	0.34
183	0.35
184	0.34
185	0.31
186	0.27
187	0.21
188	0.15
189	0.12
190	0.09
191	0.06
192	0.06
193	0.07
194	0.08
195	0.08
196	0.08
197	0.07
198	0.08
199	0.08
200	0.14
201	0.16
202	0.15
203	0.15
204	0.15
205	0.17
206	0.16
207	0.16
208	0.1
209	0.1
210	0.11
211	0.11
212	0.12
213	0.1
214	0.11
215	0.1
216	0.1
217	0.08
218	0.07
219	0.08
220	0.07
221	0.09
222	0.09
223	0.11
224	0.12
225	0.13
226	0.14
227	0.13
228	0.13
229	0.13
230	0.14
231	0.14
232	0.13
233	0.17
234	0.16
235	0.17
236	0.18
237	0.17
238	0.17
239	0.18
240	0.26
241	0.26
242	0.26
243	0.25
244	0.23
245	0.23
246	0.22
247	0.23
248	0.14
249	0.12
250	0.12
251	0.13
252	0.19
253	0.2
254	0.19
255	0.16
256	0.17
257	0.18
258	0.18
259	0.19
260	0.13
261	0.12
262	0.16
263	0.17
264	0.15
265	0.14
266	0.13
267	0.12
268	0.15
269	0.14
270	0.1
271	0.1
272	0.12
273	0.11
274	0.12
275	0.13
276	0.12
277	0.15
278	0.16
279	0.2
280	0.25
281	0.28
282	0.32
283	0.33
284	0.34
285	0.36
286	0.36
287	0.34
288	0.27
289	0.27
290	0.27
291	0.25
292	0.24
293	0.22
294	0.28
295	0.3
296	0.34
297	0.4
298	0.45
299	0.55
300	0.62
301	0.69
302	0.7
303	0.7
304	0.74
305	0.74
306	0.7
307	0.62
308	0.53
309	0.48
310	0.44
311	0.4
312	0.34
313	0.26
314	0.21
315	0.22
316	0.2
317	0.19
318	0.16
319	0.18
320	0.19
321	0.21
322	0.2
323	0.2
324	0.23
325	0.23
326	0.22
327	0.25
328	0.25
329	0.25
330	0.26
331	0.24
332	0.22
333	0.22
334	0.22
335	0.17
336	0.17
337	0.16
338	0.17
339	0.18
340	0.23
341	0.27
342	0.29
343	0.27
344	0.25
345	0.26
346	0.24
347	0.24
348	0.2
349	0.15
350	0.12
351	0.13
352	0.12
353	0.11
354	0.1
355	0.1
356	0.09
357	0.1
358	0.11
359	0.1
360	0.13
361	0.15
362	0.2
363	0.2
364	0.23
365	0.28
366	0.32
367	0.32
368	0.32
369	0.36
370	0.35
371	0.34
372	0.33
373	0.31
374	0.34
375	0.38
376	0.42
377	0.44
378	0.51
379	0.61
380	0.64
381	0.66
382	0.67
383	0.69
384	0.74
385	0.76
386	0.77
387	0.77
388	0.82
389	0.83
390	0.77
391	0.76
392	0.66
393	0.57
394	0.45
395	0.34
396	0.25
397	0.16
398	0.13
399	0.07
400	0.07
401	0.06
402	0.1
403	0.1
404	0.1
405	0.11
406	0.11
407	0.1
408	0.11
409	0.1
410	0.06
411	0.06
412	0.06
413	0.05
414	0.04
415	0.04
416	0.03
417	0.02
418	0.02
419	0.02
420	0.02
421	0.02
422	0.02
423	0.03
424	0.04

A0A2J6R2V6

3D AlphaFold-predicted Structure Viewer