Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6R7I9

Protein Details
Accession A0A2J6R7I9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
174-194YWTMCREKPNHPKGWRNGSGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
CDD cd06661  GGCT_like  
Amino Acid Sequences MYFAYGKDMDPYYLGELFHSSGATGTVEFVGVGKLSDYRWVVEPLNRFPMTVKLDEEGEVWGLVYKLSEPLMEILNSKATKRGIKMEEQEIETFEKTGLPGFWDSPLLPFGKLKVQVMVGATNNAEKAGQLQGSKKRKVLAGLLWGASEGLPEHYKAEIRAKAGGIKDPRDTQYWTMCREKPNHPKGWRNGSGDVEKVAGRRSSRLKSLDTTKTEEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.16
4 0.17
5 0.16
6 0.14
7 0.11
8 0.09
9 0.1
10 0.1
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.06
22 0.07
23 0.12
24 0.13
25 0.14
26 0.17
27 0.2
28 0.21
29 0.25
30 0.3
31 0.29
32 0.36
33 0.34
34 0.32
35 0.3
36 0.35
37 0.35
38 0.32
39 0.29
40 0.22
41 0.22
42 0.23
43 0.22
44 0.15
45 0.12
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.09
60 0.09
61 0.09
62 0.14
63 0.14
64 0.14
65 0.17
66 0.18
67 0.2
68 0.22
69 0.29
70 0.26
71 0.32
72 0.35
73 0.37
74 0.37
75 0.36
76 0.34
77 0.28
78 0.27
79 0.21
80 0.18
81 0.12
82 0.1
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.1
94 0.09
95 0.09
96 0.08
97 0.09
98 0.12
99 0.13
100 0.13
101 0.12
102 0.12
103 0.13
104 0.13
105 0.14
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.07
113 0.05
114 0.06
115 0.07
116 0.09
117 0.1
118 0.15
119 0.24
120 0.32
121 0.35
122 0.35
123 0.36
124 0.36
125 0.37
126 0.36
127 0.3
128 0.29
129 0.28
130 0.27
131 0.24
132 0.23
133 0.2
134 0.16
135 0.12
136 0.06
137 0.07
138 0.07
139 0.08
140 0.09
141 0.1
142 0.11
143 0.13
144 0.2
145 0.2
146 0.21
147 0.23
148 0.23
149 0.26
150 0.27
151 0.31
152 0.29
153 0.29
154 0.32
155 0.33
156 0.35
157 0.34
158 0.36
159 0.33
160 0.38
161 0.39
162 0.41
163 0.44
164 0.45
165 0.48
166 0.51
167 0.57
168 0.59
169 0.64
170 0.69
171 0.69
172 0.75
173 0.78
174 0.83
175 0.8
176 0.74
177 0.7
178 0.66
179 0.62
180 0.53
181 0.45
182 0.36
183 0.3
184 0.26
185 0.25
186 0.24
187 0.22
188 0.27
189 0.34
190 0.39
191 0.45
192 0.48
193 0.49
194 0.51
195 0.58
196 0.61
197 0.57
198 0.59