Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6R670

Protein Details
Accession A0A2J6R670    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-140SMAKSRTPKKAQRSLHHKKRPYAWRQPFKNKRSVIHydrophilic
NLS Segment(s)
PositionSequence
109-146KSRTPKKAQRSLHHKKRPYAWRQPFKNKRSVIRKRLLE
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MSRSYVEASARSITFSKAIRYELTRKLEEPVPTAATSYDDTSDAISEAILWEIEKTFNTVPTREVHSDDKCERFALTLLSDDEMIGDEDGMILLQATSSPLVEQDSMAKSRTPKKAQRSLHHKKRPYAWRQPFKNKRSVIRKRLLEARPASYKEKANMENAINKPENTNTRPEDADVVPGDDFNVDELFEETDEESLDHKFDIDETCEETDEDEVTMINDYTSSENELGVEEEENDLFVSKPKHVRIIPPSNSRQLVSLIRKKMSELYDLVQVKLADSEGVPDFKLAERIRGAVDKVKFDKAVDLSAADIITLHEALSLLEENQLAIDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.27
4 0.26
5 0.28
6 0.3
7 0.35
8 0.41
9 0.45
10 0.5
11 0.48
12 0.46
13 0.48
14 0.49
15 0.45
16 0.41
17 0.37
18 0.33
19 0.3
20 0.29
21 0.25
22 0.22
23 0.21
24 0.19
25 0.16
26 0.13
27 0.14
28 0.14
29 0.14
30 0.11
31 0.1
32 0.08
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.07
40 0.08
41 0.08
42 0.12
43 0.12
44 0.18
45 0.21
46 0.21
47 0.22
48 0.25
49 0.31
50 0.29
51 0.32
52 0.33
53 0.34
54 0.41
55 0.44
56 0.44
57 0.39
58 0.37
59 0.33
60 0.28
61 0.25
62 0.2
63 0.16
64 0.15
65 0.14
66 0.14
67 0.14
68 0.12
69 0.11
70 0.1
71 0.09
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.07
90 0.07
91 0.1
92 0.13
93 0.14
94 0.15
95 0.17
96 0.2
97 0.28
98 0.37
99 0.42
100 0.47
101 0.55
102 0.64
103 0.7
104 0.76
105 0.78
106 0.8
107 0.83
108 0.85
109 0.82
110 0.77
111 0.79
112 0.79
113 0.77
114 0.78
115 0.77
116 0.78
117 0.8
118 0.86
119 0.87
120 0.82
121 0.81
122 0.75
123 0.73
124 0.74
125 0.75
126 0.74
127 0.72
128 0.7
129 0.65
130 0.69
131 0.62
132 0.59
133 0.51
134 0.46
135 0.42
136 0.43
137 0.42
138 0.36
139 0.36
140 0.31
141 0.34
142 0.31
143 0.28
144 0.28
145 0.27
146 0.31
147 0.29
148 0.32
149 0.27
150 0.25
151 0.24
152 0.24
153 0.27
154 0.22
155 0.27
156 0.23
157 0.25
158 0.25
159 0.25
160 0.25
161 0.2
162 0.2
163 0.15
164 0.14
165 0.12
166 0.11
167 0.11
168 0.07
169 0.07
170 0.05
171 0.05
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.05
188 0.06
189 0.07
190 0.09
191 0.09
192 0.11
193 0.12
194 0.12
195 0.12
196 0.12
197 0.11
198 0.09
199 0.08
200 0.06
201 0.05
202 0.05
203 0.06
204 0.05
205 0.05
206 0.04
207 0.05
208 0.06
209 0.07
210 0.09
211 0.09
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.06
224 0.06
225 0.09
226 0.1
227 0.14
228 0.2
229 0.22
230 0.29
231 0.31
232 0.38
233 0.45
234 0.54
235 0.57
236 0.6
237 0.63
238 0.63
239 0.63
240 0.55
241 0.47
242 0.4
243 0.4
244 0.41
245 0.44
246 0.44
247 0.44
248 0.44
249 0.44
250 0.46
251 0.4
252 0.35
253 0.3
254 0.26
255 0.33
256 0.33
257 0.32
258 0.29
259 0.26
260 0.22
261 0.2
262 0.18
263 0.11
264 0.09
265 0.12
266 0.11
267 0.12
268 0.12
269 0.12
270 0.13
271 0.13
272 0.21
273 0.18
274 0.22
275 0.22
276 0.23
277 0.26
278 0.28
279 0.3
280 0.29
281 0.32
282 0.35
283 0.37
284 0.4
285 0.38
286 0.35
287 0.39
288 0.34
289 0.34
290 0.27
291 0.24
292 0.2
293 0.21
294 0.2
295 0.13
296 0.11
297 0.08
298 0.09
299 0.09
300 0.08
301 0.07
302 0.07
303 0.07
304 0.1
305 0.1
306 0.08
307 0.1
308 0.1
309 0.1