Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2J6S4Q9

Protein Details
Accession A0A2J6S4Q9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-66KISPKHQFRLERKYKRRAKLKWARPRWTKAVKIBasic
NLS Segment(s)
PositionSequence
38-62KHQFRLERKYKRRAKLKWARPRWTK
Subcellular Location(s) mito 16, mito_nucl 12.333, nucl 6.5, cyto_nucl 5.666, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFSTLLRRSAQQSTPFVYTNPYKARRLWPPDFTKISPKHQFRLERKYKRRAKLKWARPRWTKAVKIVQMGSIVCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.36
4 0.35
5 0.31
6 0.32
7 0.36
8 0.37
9 0.36
10 0.39
11 0.45
12 0.49
13 0.55
14 0.54
15 0.54
16 0.55
17 0.6
18 0.6
19 0.55
20 0.55
21 0.51
22 0.53
23 0.54
24 0.5
25 0.47
26 0.49
27 0.57
28 0.54
29 0.61
30 0.64
31 0.66
32 0.72
33 0.79
34 0.81
35 0.81
36 0.85
37 0.81
38 0.81
39 0.81
40 0.84
41 0.84
42 0.86
43 0.86
44 0.85
45 0.86
46 0.84
47 0.82
48 0.78
49 0.76
50 0.76
51 0.7
52 0.67
53 0.61
54 0.54
55 0.48