Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2J6R5V7

Protein Details
Accession A0A2J6R5V7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ADSRRKWSSKGPQKMSRKIPSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 11, extr 2
Family & Domain DBs
Amino Acid Sequences MADSRRKWSSKGPQKMSRKIPSVRFLLVLVCLIYARTAGRERKVDTIKERARLIHGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.85
4 0.81
5 0.78
6 0.73
7 0.71
8 0.66
9 0.6
10 0.52
11 0.43
12 0.36
13 0.29
14 0.23
15 0.16
16 0.1
17 0.07
18 0.06
19 0.05
20 0.04
21 0.05
22 0.04
23 0.07
24 0.13
25 0.17
26 0.22
27 0.27
28 0.29
29 0.38
30 0.43
31 0.46
32 0.47
33 0.54
34 0.55
35 0.56
36 0.56
37 0.5