Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SXP0

Protein Details
Accession G0SXP0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39KIPYRLTPTRKTRQRLRLKAVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.833, cyto_nucl 1.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQTALGGLLWKIPYRLTPTRKTRQRLRLKAVDDVIAKVQASGVQTHSLTKGLAPPNGPEKPGPDKYPGFLRDRRNYRKGIHQGPDWTQGTLRLNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.14
8 0.21
9 0.3
10 0.34
11 0.43
12 0.51
13 0.62
14 0.69
15 0.74
16 0.76
17 0.78
18 0.83
19 0.82
20 0.81
21 0.78
22 0.73
23 0.7
24 0.61
25 0.55
26 0.44
27 0.36
28 0.28
29 0.21
30 0.18
31 0.13
32 0.11
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.09
39 0.1
40 0.11
41 0.1
42 0.09
43 0.08
44 0.13
45 0.13
46 0.15
47 0.15
48 0.16
49 0.23
50 0.24
51 0.25
52 0.2
53 0.22
54 0.28
55 0.32
56 0.32
57 0.31
58 0.31
59 0.32
60 0.4
61 0.39
62 0.38
63 0.41
64 0.47
65 0.51
66 0.61
67 0.67
68 0.65
69 0.67
70 0.64
71 0.69
72 0.69
73 0.68
74 0.64
75 0.61
76 0.61
77 0.6
78 0.65
79 0.55
80 0.47
81 0.38
82 0.37
83 0.37
84 0.37
85 0.39